StarFunc result for job id Q9NQ36

User Input

>input (999 residues)
MGVAGRNRPGAAWAVLLLLLLLPPLLLLAGAVPPGRGRAAGPQEDVDECAQGLDDCHADA
LCQNTPTSYKCSCKPGYQGEGRQCEDIDECGNELNGGCVHDCLNIPGNYRCTCFDGFMLA
HDGHNCLDVDECLENNGGCQHTCVNVMGSYECCCKEGFFLSDNQHTCIHRSEEGLSCMNK
DHGCSHICKEAPRGSVACECRPGFELAKNQRDCILTCNHGNGGCQHSCDDTADGPECSCH
PQYKMHTDGRSCLEREDTVLEVTESNTTSVVDGDKRVKRRLLMETCAVNNGGCDRTCKDT
STGVHCSCPVGFTLQLDGKTCKDIDECQTRNGGCDHFCKNIVGSFDCGCKKGFKLLTDEK
SCQDVDECSLDRTCDHSCINHPGTFACACNRGYTLYGFTHCGDTNECSINNGGCQQVCVN
TVGSYECQCHPGYKLHWNKKDCVEVKGLLPTSVSPRVSLHCGKSGGGDGCFLRCHSGIHL
SSDVTTIRTSVTFKLNEGKCSLKNAELFPEGLRPALPEKHSSVKESFRYVNLTCSSGKQV
PGAPGRPSTPKEMFITVEFELETNQKEVTASCDLSCIVKRTEKRLRKAIRTLRKAVHREQ
FHLQLSGMNLDVAKKPPRTSERQAESCGVGQGHAENQCVSCRAGTYYDGARERCILCPNG
TFQNEEGQMTCEPCPRPGNSGALKTPEAWNMSECGGLCQPGEYSADGFAPCQLCALGTFQ
PEAGRTSCFPCGGGLATKHQGATSFQDCETRVQCSPGHFYNTTTHRCIRCPVGTYQPEFG
KNNCVSCPGNTTTDFDGSTNITQCKNRRCGGELGDFTGYIESPNYPGNYPANTECTWTIN
PPPKRRILIVVPEIFLPIEDDCGDYLVMRKTSSSNSVTTYETCQTYERPIAFTSRSKKLW
IQFKSNEGNSARGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLIKALFDV
LAHPQNYFKYTAQESREMFPRSFIRLLRSKVSRFLRPYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IBT9	0.552	0.554	0.000	994	0.621	0.624	A0A0R4IBT9.pdb.gz	A0A0R4IBT9_DANRE Signal peptide, CUB and EGF-like domain-containing protein 1 isoform 2 precursor OS=Danio rerio OX=7955 GN=im:7427863 PE=4 SV=1
2	AFDB:A0A2R8Q191	0.532	0.530	0.000	1002	0.581	0.579	A0A2R8Q191.pdb.gz
3	AFDB:M1FTT7	0.626	0.612	0.000	1024	0.649	0.633	M1FTT7.pdb.gz
4	AFDB:Q5G872	0.716	0.709	0.000	1010	0.674	0.666	Q5G872.pdb.gz	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
5	AFDB:Q66PY1	0.544	0.547	0.000	993	0.594	0.597	Q66PY1.pdb.gz	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
6	AFDB:Q6NZL8	0.677	0.665	0.000	1018	0.663	0.650	Q6NZL8.pdb.gz	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
7	AFDB:Q8IWY4	0.525	0.531	0.000	988	0.643	0.650	Q8IWY4.pdb.gz	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
8	AFDB:Q9JJS0	0.889	0.891	0.000	997	0.891	0.893	Q9JJS0.pdb.gz	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
9	AFDB:Q9NQ36	1.000	1.000	0.000	999	1.000	1.000	Q9NQ36.pdb.gz	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
10	AFDB:O75095	0.095	0.066	4.748E-31	1541	0.194	0.126	O75095.pdb.gz	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
11	PDB:7q3nU	0.082	0.215	1.907E-6	292	0.057	0.195	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
12	PDB:7b01A	0.087	0.141	5.421E-3	588	0.025	0.043	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
13	PDB:3am2A	0.082	0.240	9.244E-3	286	0.007	0.024	3am2A.pdb.gz
14	PDB:4dxzA	0.072	0.437	1.952E-2	111	0.012	0.108	4dxzA.pdb.gz
15	PDB:1ft9A	0.064	0.211	7.411E-2	210	0.012	0.057	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
16	PDB:6xwuA	0.060	0.301	1.198E-1	138	0.006	0.043	6xwuA.pdb.gz
17	PDB:4uybA	0.067	0.134	1.483E-1	401	0.011	0.027	4uybA.pdb.gz
18	PDB:3lxuX	0.084	0.071	1.650E-1	1217	0.018	0.015	3lxuX.pdb.gz
19	PDB:4tlgA	0.063	0.123	1.937E-1	396	0.013	0.033	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
20	PDB:3qqxA	0.048	0.088	2.043E-1	474	0.005	0.011	3qqxA.pdb.gz	CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IBT9	0.0	1268	994	0.636	0.639	A0A0R4IBT9_DANRE Signal peptide, CUB and EGF-like domain-containing protein 1 isoform 2 precursor OS=Danio rerio OX=7955 GN=im:7427863 PE=4 SV=1
2	F1R0I7	0.0	1186	995	0.582	0.584	F1R0I7_DANRE Scube3 OS=Danio rerio OX=7955 GN=scube3 PE=2 SV=3
3	Q5G872	0.0	1375	1010	0.667	0.659	SCUB2_DANRE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Danio rerio OX=7955 GN=scube2 PE=2 SV=1
4	Q66PY1	0.0	1202	993	0.595	0.598	SCUB3_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Mus musculus OX=10090 GN=Scube3 PE=1 SV=1
5	Q6NZL8	0.0	1354	1018	0.672	0.659	SCUB1_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Mus musculus OX=10090 GN=Scube1 PE=2 SV=2
6	Q8IWY4	0.0	1305	988	0.649	0.656	SCUB1_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCUBE1 PE=1 SV=3
7	Q8IX30	0.0	1207	993	0.597	0.600	SCUB3_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 3 OS=Homo sapiens OX=9606 GN=SCUBE3 PE=1 SV=1
8	Q9JJS0	0.0	1811	997	0.888	0.890	SCUB2_MOUSE Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Mus musculus OX=10090 GN=Scube2 PE=1 SV=1
9	Q9NQ36	0.0	2060	999	1.000	1.000	SCUB2_HUMAN Signal peptide, CUB and EGF-like domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SCUBE2 PE=1 SV=3
10	Q86TI6	3.04e-155	464	347	0.222	0.640	Q86TI6_HUMAN SCUBE1 protein OS=Homo sapiens OX=9606 GN=SCUBE1 PE=2 SV=1
11	M9PHP7	6.13e-62	233	1427	0.171	0.120	M9PHP7_DROME Faulty attraction, isoform F OS=Drosophila melanogaster OX=7227 GN=frac PE=4 SV=1
12	Q9VS89	6.76e-57	217	1618	0.155	0.096	Q9VS89_DROME FI18763p1 OS=Drosophila melanogaster OX=7227 GN=frac PE=2 SV=4
13	O08746	1.65e-56	214	956	0.140	0.146	MATN2_MOUSE Matrilin-2 OS=Mus musculus OX=10090 GN=Matn2 PE=2 SV=2
14	O00339	2.55e-56	213	956	0.137	0.143	MATN2_HUMAN Matrilin-2 OS=Homo sapiens OX=9606 GN=MATN2 PE=1 SV=4
15	Q80V70	6.51e-53	204	1572	0.135	0.086	MEGF6_MOUSE Multiple epidermal growth factor-like domains protein 6 OS=Mus musculus OX=10090 GN=Megf6 PE=2 SV=3
16	F1S0M0	4.04e-51	197	879	0.132	0.150	F1S0M0_PIG Matrilin 2 OS=Sus scrofa OX=9823 GN=MATN2 PE=1 SV=4
17	O75095	4.37e-45	179	1541	0.128	0.083	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
18	P35556	1.05e-42	172	2912	0.141	0.048	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
19	Q61555	2.05e-41	168	2907	0.138	0.047	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
20	B6CS38	1.92e-39	162	2868	0.141	0.049	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	8.3e-41	148.8	Complement Clr-like EGF-like
2	PF00431 CUB	1.9e-15	68.5	CUB domain
3	PF14300 DUF4375	5.8e+02	12.1	Domain of unknown function (DUF4375)
4	PF00008 EGF	1.4e-09	49.4	EGF-like domain
5	PF12947 EGF_3	1.7e-19	81.0	EGF domain
6	PF07645 EGF_CA	1.1e-25	100.8	Calcium-binding EGF domain
7	PF07699 Ephrin_rec_like	5.5e-38	139.8	Tyrosine-protein kinase ephrin type A/B receptor-like
8	PF14670 FXa_inhibition	1.9e-55	196.2	Coagulation Factor Xa inhibitory site
9	PF12661 hEGF	1.9	20.5	Human growth factor-like EGF

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000005841

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000058528	0.847	Myosin IXB
2	9598.ENSPTRP00000034099	0.808	Uncharacterized protein
3	9598.ENSPTRP00000027900	0.757	Uncharacterized protein
4	9598.ENSPTRP00000039391	0.669	Suppression of tumorigenicity 5
5	9598.ENSPTRP00000001152	0.663	Uncharacterized protein
6	9598.ENSPTRP00000021111	0.655	Uncharacterized protein
7	9598.ENSPTRP00000050291	0.653	Neuralized E3 ubiquitin protein ligase 1
8	9598.ENSPTRP00000058713	0.653	Neuralized E3 ubiquitin protein ligase 1B
9	9598.ENSPTRP00000056675	0.644	Signal peptide, CUB domain, EGF-like 3
10	9598.ENSPTRP00000046388	0.638	SCL/TAL1 interrupting locus
11	9598.ENSPTRP00000018853	0.613	Uncharacterized protein
12	9598.ENSPTRP00000003280	0.603	Hedgehog acyltransferase
13	9598.ENSPTRP00000022106	0.593	Hedgehog protein
14	9598.ENSPTRP00000053162	0.592	PITPNM family member 3
15	9598.ENSPTRP00000011943	0.591	Adenosine deaminase-like
16	9598.ENSPTRP00000054795	0.570	Complement component 1, s subcomponent
17	9598.ENSPTRP00000003373	0.567	Dispatched RND transporter family member 1
18	9598.ENSPTRP00000031695	0.561	Uncharacterized protein
19	9598.ENSPTRP00000027848	0.550	Belongs to the ATR family
20	9598.ENSPTRP00000013860	0.540	Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.486	signaling receptor binding
GO:0043167	0.450	ion binding
GO:0046872	0.425	metal ion binding
GO:0042802	0.310	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0009987	0.990	cellular process
GO:0050794	0.983	regulation of cellular process
GO:0048856	0.919	anatomical structure development
GO:0048518	0.889	positive regulation of biological process
GO:0048583	0.879	regulation of response to stimulus
GO:0010646	0.871	regulation of cell communication
GO:0023051	0.863	regulation of signaling
GO:0048522	0.853	positive regulation of cellular process
GO:0009966	0.831	regulation of signal transduction
GO:0008589	0.784	regulation of smoothened signaling pathway
GO:0023056	0.779	positive regulation of signaling
GO:0010647	0.779	positive regulation of cell communication
GO:0007275	0.771	multicellular organism development
GO:0009967	0.728	positive regulation of signal transduction
GO:0048513	0.718	animal organ development
GO:0045880	0.635	positive regulation of smoothened signaling pathway
GO:0045595	0.630	regulation of cell differentiation
GO:0051716	0.525	cellular response to stimulus
GO:0007154	0.401	cell communication
GO:0007165	0.388	signal transduction
GO:0030154	0.363	cell differentiation
GO:0007166	0.354	cell surface receptor signaling pathway
GO:0045667	0.353	regulation of osteoblast differentiation
GO:0048731	0.332	system development
GO:0048519	0.311	negative regulation of biological process
GO:0009888	0.302	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005622	0.625	intracellular anatomical structure
GO:0043226	0.603	organelle
GO:0043227	0.591	membrane-bounded organelle
GO:0005737	0.589	cytoplasm
GO:0071944	0.485	cell periphery
GO:0016020	0.430	membrane
GO:0005886	0.407	plasma membrane
GO:0012505	0.362	endomembrane system
GO:0043231	0.307	intracellular membrane-bounded organelle
GO:0005615	0.306	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]