StarFunc result for job id Q9NQ38

User Input

>input (1064 residues)
MKIATVSVLLPLALCLIQDAASKNEDQEMCHEFQAFMKNGKLFCPQDKKFFQSLDGIMFI
NKCATCKMILEKEAKSQKRARHLARAPKATAPTELNCDDFKKGERDGDFICPDYYEAVCG
TDGKTYDNRCALCAENAKTGSQIGVKSEGECKSSNPEQDVCSAFRPFVRDGRLGCTREND
PVLGPDGKTHGNKCAMCAELFLKEAENAKREGETRIRRNAEKDFCKEYEKQVRNGRLFCT
RESDPVRGPDGRMHGNKCALCAEIFKQRFSEENSKTDQNLGKAEEKTKVKREIVKLCSQY
QNQAKNGILFCTRENDPIRGPDGKMHGNLCSMCQAYFQAENEEKKKAEARARNKRESGKA
TSYAELCSEYRKLVRNGKLACTRENDPIQGPDGKVHGNTCSMCEVFFQAEEEEKKKKEGK
SRNKRQSKSTASFEELCSEYRKSRKNGRLFCTRENDPIQGPDGKMHGNTCSMCEAFFQQE
ERARAKAKREAAKEICSEFRDQVRNGTLICTREHNPVRGPDGKMHGNKCAMCASVFKLEE
EEKKNDKEEKGKVEAEKVKREAVQELCSEYRHYVRNGRLPCTRENDPIEGLDGKIHGNTC
SMCEAFFQQEAKEKERAEPRAKVKREAEKETCDEFRRLLQNGKLFCTRENDPVRGPDGKT
HGNKCAMCKAVFQKENEERKRKEEEDQRNAAGHGSSGGGGGNTQDECAEYREQMKNGRLS
CTRESDPVRDADGKSYNNQCTMCKAKLEREAERKNEYSRSRSNGTGSESGKDTCDEFRSQ
MKNGKLICTRESDPVRGPDGKTHGNKCTMCKEKLEREAAEKKKKEDEDRSNTGERSNTGE
RSNDKEDLCREFRSMQRNGKLICTRENNPVRGPYGKMHINKCAMCQSIFDREANERKKKD
EEKSSSKPSNNAKDECSEFRNYIRNNELICPRENDPVHGADGKFYTNKCYMCRAVFLTEA
LERAKLQEKPSHVRASQEEDSPDSFSSLDSEMCKDYRVLPRIGYLCPKDLKPVCGDDGQT
YNNPCMLCHENLIRQTNTHIRSTGKCEESSTPGTTAASMPPSDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q148R4	0.179	0.184	0.000	1017	0.600	0.627	Q148R4.pdb.gz	Q148R4_MOUSE Serine peptidase inhibitor, Kazal type 5 OS=Mus musculus OX=10090 GN=Spink5 PE=1 SV=1
2	AFDB:Q9NQ38	1.000	1.000	0.000	1064	1.000	1.000	Q9NQ38.pdb.gz	ISK5_HUMAN Serine protease inhibitor Kazal-type 5 OS=Homo sapiens OX=9606 GN=SPINK5 PE=1 SV=2
3	AFDB:G1MZX1	0.079	0.139	1.983E-11	540	0.115	0.226	G1MZX1.pdb.gz	G1MZX1_MELGA Kazal-like domain-containing protein OS=Meleagris gallopavo OX=9103 PE=4 SV=2
4	AFDB:P25304	0.055	0.040	5.142E-11	1959	0.150	0.082	P25304.pdb.gz	AGRIN_RAT Agrin OS=Rattus norvegicus OX=10116 GN=Agrn PE=1 SV=2
5	AFDB:P10184	0.081	0.137	2.973E-10	517	0.116	0.238	P10184.pdb.gz	IOV7_CHICK Ovoinhibitor OS=Gallus gallus OX=9031 GN=SPINK5 PE=1 SV=3
6	AFDB:P31696	0.076	0.048	5.998E-10	2081	0.161	0.082	P31696.pdb.gz	AGRIN_CHICK Agrin OS=Gallus gallus OX=9031 GN=AGRN PE=1 SV=3
7	AFDB:O00468	0.075	0.045	7.330E-10	2068	0.153	0.079	O00468.pdb.gz	AGRIN_HUMAN Agrin OS=Homo sapiens OX=9606 GN=AGRN PE=1 SV=6
8	AFDB:F1R074	0.068	0.045	2.322E-9	2026	0.154	0.081	F1R074.pdb.gz
9	AFDB:O96790	0.058	0.128	2.013E-7	351	0.081	0.245	O96790.pdb.gz	DPGN_DIPMA Serine protease inhibitor dipetalogastin (Fragment) OS=Dipetalogaster maximus OX=72496 PE=1 SV=2
10	AFDB:P01005	0.073	0.321	1.001E-6	210	0.051	0.257	P01005.pdb.gz	IOVO_CHICK Ovomucoid OS=Gallus gallus OX=9031 PE=1 SV=1
11	PDB:2leoA	0.051	0.634	8.140E-3	66	0.022	0.348	2leoA.pdb.gz
12	PDB:7qe9C	0.048	0.728	9.462E-3	60	0.021	0.367	7qe9C.pdb.gz
13	PDB:2p6aD	0.049	0.153	2.579E-2	292	0.030	0.110	2p6aD.pdb.gz	Structural and biophysical coupling of heparin and activin binding to follistatin isoform functions.
14	PDB:1yu6C	0.044	0.723	3.484E-2	51	0.015	0.314	1yu6C.pdb.gz	Structure of the subtilisin Carlsberg-OMTKY3 complex reveals two different ovomucoid conformations.
15	PDB:3b4vD	0.059	0.189	1.161E-1	213	0.023	0.113	3b4vD.pdb.gz
16	PDB:2xrcC	0.039	0.089	1.739	454	0.008	0.020	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
17	PDB:7oniR	0.032	0.285	2.471	86	0.015	0.186	7oniR.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
18	PDB:2xrcB	0.044	0.092	2.872	485	0.008	0.016	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
19	PDB:5i08A	0.041	0.045	4.289	958	0.010	0.011	5i08A.pdb.gz
20	PDB:3j79V	0.022	0.131	4.985	155	0.009	0.065	3j79V.pdb.gz	Cryo-EM structure of the Plasmodium falciparum 80S ribosome bound to the anti-protozoan drug emetine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EWP9	0.0	1755	869	0.817	1.000	E7EWP9_HUMAN Serine peptidase inhibitor Kazal type 5 (Fragment) OS=Homo sapiens OX=9606 GN=SPINK5 PE=1 SV=1
2	Q148R4	0.0	1020	1017	0.523	0.547	Q148R4_MOUSE Serine peptidase inhibitor, Kazal type 5 OS=Mus musculus OX=10090 GN=Spink5 PE=1 SV=1
3	Q3TRK5	0.0	555	600	0.288	0.510	Q3TRK5_MOUSE Kazal-like domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Spink5 PE=2 SV=1
4	Q5K5D4	0.0	1020	1017	0.523	0.547	Q5K5D4_MOUSE Spink5 protein OS=Mus musculus OX=10090 GN=Spink5 PE=2 SV=1
5	Q8BM18	0.0	556	601	0.288	0.509	Q8BM18_MOUSE Kazal-like domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Spink5 PE=2 SV=1
6	Q8BM23	0.0	689	708	0.354	0.532	Q8BM23_MOUSE Kazal-like domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Spink5 PE=2 SV=1
7	Q9NQ38	0.0	2175	1064	1.000	1.000	ISK5_HUMAN Serine protease inhibitor Kazal-type 5 OS=Homo sapiens OX=9606 GN=SPINK5 PE=1 SV=2
8	P10184	2.01e-39	156	517	0.130	0.267	IOV7_CHICK Ovoinhibitor OS=Gallus gallus OX=9031 GN=SPINK5 PE=1 SV=3
9	G1MZX1	1.85e-35	145	540	0.128	0.252	G1MZX1_MELGA Kazal-like domain-containing protein OS=Meleagris gallopavo OX=9103 PE=4 SV=2
10	P01005	1.97e-17	84.3	210	0.059	0.300	IOVO_CHICK Ovomucoid OS=Gallus gallus OX=9031 PE=1 SV=1
11	P68390	7.75e-15	76.3	185	0.050	0.286	IOVO_MELGA Ovomucoid OS=Meleagris gallopavo OX=9103 PE=1 SV=1
12	O96790	4.16e-10	65.1	351	0.076	0.231	DPGN_DIPMA Serine protease inhibitor dipetalogastin (Fragment) OS=Dipetalogaster maximus OX=72496 PE=1 SV=2
13	Q8BT20	3.88e-07	51.6	105	0.023	0.238	ISK6_MOUSE Serine protease inhibitor Kazal-type 6 OS=Mus musculus OX=10090 GN=Spink6 PE=2 SV=1
14	P09656	4.09e-07	50.8	79	0.022	0.291	ISK1L_RAT Serine protease inhibitor Kazal-type 1-like OS=Rattus norvegicus OX=10116 GN=Spink1l PE=1 SV=2
15	P09655	2.70e-06	48.5	79	0.019	0.253	ISK1_RAT Serine protease inhibitor Kazal-type 1 OS=Rattus norvegicus OX=10116 GN=Spink1 PE=1 SV=2
16	Q6UWN8	2.94e-06	48.5	80	0.021	0.275	ISK6_HUMAN Serine protease inhibitor Kazal-type 6 OS=Homo sapiens OX=9606 GN=SPINK6 PE=1 SV=1
17	Q5GMQ7	4.97e-06	47.8	81	0.023	0.296	Q5GMQ7_MELGA Kazal-type serine proteinase inhibitor OS=Meleagris gallopavo OX=9103 GN=turkinh1 PE=2 SV=1
18	P00995	7.33e-06	47.4	79	0.021	0.278	ISK1_HUMAN Serine protease inhibitor Kazal-type 1 OS=Homo sapiens OX=9606 GN=SPINK1 PE=1 SV=2
19	P85000	8.27e-06	46.2	55	0.023	0.436	ISK1L_CHICK Trypsin inhibitor ClTI-1 OS=Gallus gallus OX=9031 PE=1 SV=1
20	B3GQ72	1.67e-05	51.6	2028	0.095	0.050	B3GQ72_DANRE Agrin OS=Danio rerio OX=7955 GN=wu:fb57e07 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18007 DUF5593	0.17	23.9	Domain of unknown function (DUF5593)
2	PF00050 Kazal_1	7.5e-93	315.7	Kazal-type serine protease inhibitor domain
3	PF07648 Kazal_2	5.5e-41	149.8	Kazal-type serine protease inhibitor domain
4	PF18299 R2K_2	7.6e+02	11.3	ATP-grasp domain, R2K clade family 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352936

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000337733	0.951	Kallikrein-5
2	9606.ENSP00000324870	0.788	Serine protease inhibitor Kazal-type 6
3	9606.ENSP00000274565	0.776	Serine protease inhibitor Kazal-type 7
4	9606.ENSP00000375683	0.774	Kallikrein-7
5	9606.ENSP00000278742	0.764	Suppressor of tumorigenicity 14 protein
6	9606.ENSP00000236850	0.753	Apolipoprotein A-I
7	9606.ENSP00000425961	0.749	Serine peptidase inhibitor, Kazal type 2
8	9606.ENSP00000367139	0.742	Serine protease inhibitor Kazal-type 9
9	9606.ENSP00000357789	0.737	Filaggrin
10	9606.ENSP00000365465	0.730	Corneodesmosin
11	9606.ENSP00000257192	0.711	Desmoglein-1
12	9606.ENSP00000366047	0.710	Kallikrein-6
13	9606.ENSP00000375678	0.709	Kallikrein-14
14	9606.ENSP00000369045	0.700	Serine peptidase inhibitor, Kazal type 4
15	9606.ENSP00000326159	0.661	Kallikrein-4
16	9606.ENSP00000363868	0.621	ATP-binding cassette sub-family A member 1
17	9606.ENSP00000473047	0.615	Kallikrein-11
18	9606.ENSP00000339804	0.601	Thymic stromal lymphopoietin
19	9606.ENSP00000470555	0.599	Kallikrein-13
20	9606.ENSP00000231706	0.585	Probable cationic amino acid transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0005515	0.482	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0050794	0.977	regulation of cellular process
GO:0048519	0.974	negative regulation of biological process
GO:0009987	0.969	cellular process
GO:0008544	0.929	epidermis development
GO:0048583	0.890	regulation of response to stimulus
GO:0032501	0.875	multicellular organismal process
GO:0002682	0.853	regulation of immune system process
GO:0071840	0.769	cellular component organization or biogenesis
GO:0016043	0.756	cellular component organization
GO:0051239	0.722	regulation of multicellular organismal process
GO:0060429	0.720	epithelium development
GO:0002683	0.683	negative regulation of immune system process
GO:0050776	0.574	regulation of immune response
GO:0048585	0.570	negative regulation of response to stimulus
GO:0043062	0.542	extracellular structure organization
GO:0009913	0.526	epidermal cell differentiation
GO:0050777	0.521	negative regulation of immune response
GO:0045229	0.491	external encapsulating structure organization
GO:0019222	0.473	regulation of metabolic process
GO:0050793	0.449	regulation of developmental process
GO:0060255	0.441	regulation of macromolecule metabolic process
GO:0007275	0.402	multicellular organism development
GO:0051336	0.362	regulation of hydrolase activity
GO:0048518	0.353	positive regulation of biological process
GO:0008152	0.314	metabolic process
GO:2000026	0.312	regulation of multicellular organismal development
GO:0080090	0.304	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0016020	0.987	membrane
GO:0005576	0.986	extracellular region
GO:0005737	0.975	cytoplasm
GO:0031982	0.961	vesicle
GO:0071944	0.955	cell periphery
GO:0099503	0.920	secretory vesicle
GO:0030141	0.911	secretory granule
GO:0005829	0.774	cytosol
GO:0031090	0.699	organelle membrane
GO:0005783	0.694	endoplasmic reticulum
GO:0031984	0.490	organelle subcompartment
GO:0042175	0.426	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0042599	0.414	lamellar body
GO:0098827	0.398	endoplasmic reticulum subcompartment
GO:0097209	0.390	epidermal lamellar body
GO:0005789	0.381	endoplasmic reticulum membrane
GO:0048471	0.356	perinuclear region of cytoplasm
GO:0005634	0.318	nucleus
GO:0005938	0.316	cell cortex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]