StarFunc result for job id Q9NQ48

User Input

>input (299 residues)
MAELGLNEHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDTFTIDEVSEVLNG
LQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKA
EITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALD
EKSKLEKALQDLQLDQGNQKDFIKAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENL
ATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYEPED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JHQ5	0.488	0.488	6.846E-35	299	0.910	0.910	Q9JHQ5.pdb.gz	LZTL1_MOUSE Leucine zipper transcription factor-like protein 1 OS=Mus musculus OX=10090 GN=Lztfl1 PE=1 SV=1
2	AFDB:A0A0R4IUZ0	0.488	0.490	1.139E-27	298	0.689	0.691	A0A0R4IUZ0.pdb.gz
3	AFDB:A0A0R4IXN4	0.432	0.520	1.310E-22	247	0.585	0.709	A0A0R4IXN4.pdb.gz
4	AFDB:A0A0R4ISB5	0.473	0.535	7.823E-18	261	0.599	0.686	A0A0R4ISB5.pdb.gz
5	AFDB:Q8NEF3	0.292	0.209	2.937E-1	446	0.167	0.112	Q8NEF3.pdb.gz	CC112_HUMAN Coiled-coil domain-containing protein 112 OS=Homo sapiens OX=9606 GN=CCDC112 PE=1 SV=2
6	AFDB:O14010	0.174	0.341	3.817E-1	136	0.070	0.154	O14010.pdb.gz	MED22_SCHPO Mediator of RNA polymerase II transcription subunit 22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med22 PE=1 SV=1
7	AFDB:G5EFF2	0.312	0.278	4.075E-1	348	0.194	0.167	G5EFF2.pdb.gz	G5EFF2_CAEEL ELKS/RAB6-interacting/CAST family member 2 OS=Caenorhabditis elegans OX=6239 GN=CELE_F20C5.6 PE=1 SV=2
8	AFDB:Q386V6	0.344	0.198	5.653E-1	568	0.140	0.074	Q386V6.pdb.gz	Q386V6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0004 PE=4 SV=1
9	PDB:7c4jH	0.145	0.169	6.425E-1	242	0.107	0.132	7c4jH.pdb.gz
10	PDB:1qsdA	0.164	0.384	8.348E-1	102	0.040	0.118	1qsdA.pdb.gz
11	PDB:7qpgR	0.102	0.024	8.913E-1	2208	0.074	0.010	7qpgR.pdb.gz
12	AFDB:P13096	0.128	0.203	8.938E-1	178	0.064	0.107	P13096.pdb.gz	ESM5_DROME Enhancer of split m5 protein OS=Drosophila melanogaster OX=7227 GN=E(spl)m5-HLH PE=1 SV=1
13	AFDB:Q10207	0.176	0.100	8.938E-1	584	0.090	0.046	Q10207.pdb.gz	YBX1_SCHPO Uncharacterized protein C17D1.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC17D1.01 PE=4 SV=2
14	PDB:5n9jG	0.134	0.210	1.409	163	0.060	0.110	5n9jG.pdb.gz
15	PDB:6tuyA	0.172	0.091	1.409	667	0.064	0.028	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
16	PDB:6v4uB	0.133	0.107	1.831	421	0.057	0.040	6v4uB.pdb.gz
17	PDB:6qlfU	0.100	0.160	2.229	171	0.107	0.187	6qlfU.pdb.gz
18	PDB:7d5sB2	0.155	0.067	2.540	851	0.047	0.016	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
19	PDB:5n9jZ	0.178	0.344	2.712	119	0.054	0.134	5n9jZ.pdb.gz
20	PDB:6wczA	0.173	0.152	2.896	350	0.050	0.043	6wczA.pdb.gz	Structural basis for STAT2 suppression by flavivirus NS5.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9JHQ5	0.0	547	299	0.910	0.910	LZTL1_MOUSE Leucine zipper transcription factor-like protein 1 OS=Mus musculus OX=10090 GN=Lztfl1 PE=1 SV=1
2	Q9NQ48	0.0	595	299	1.000	1.000	LZTL1_HUMAN Leucine zipper transcription factor-like protein 1 OS=Homo sapiens OX=9606 GN=LZTFL1 PE=1 SV=1
3	H7C488	6.79e-161	449	235	0.783	0.996	H7C488_HUMAN Leucine zipper transcription factor-like protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=LZTFL1 PE=1 SV=1
4	Q7ZV21	1.44e-145	412	298	0.689	0.691	Q7ZV21_DANRE Leucine zipper transcription factor-like protein 1 OS=Danio rerio OX=7955 GN=fb53f12 PE=1 SV=1
5	C1P640	0.010	40.0	3683	0.124	0.010	C1P640_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
6	C1P641	0.010	40.0	3663	0.124	0.010	C1P641_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
7	G5EEV6	0.010	40.0	3704	0.124	0.010	G5EEV6_CAEEL Laminin alpha OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
8	Q21313	0.010	40.0	3672	0.124	0.010	EPI1_CAEEL Laminin-like protein epi-1 OS=Caenorhabditis elegans OX=6239 GN=epi-1 PE=1 SV=1
9	D3ZQN7	0.015	39.7	1786	0.184	0.031	D3ZQN7_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=3
10	A0A8I5ZQ25	0.017	39.3	1834	0.184	0.030	A0A8I5ZQ25_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
11	A0A8I6A3T2	0.017	39.3	1792	0.184	0.031	A0A8I6A3T2_RAT Laminin subunit beta 1 OS=Rattus norvegicus OX=10116 GN=Lamb1 PE=1 SV=1
12	P02469	0.029	38.5	1786	0.197	0.033	LAMB1_MOUSE Laminin subunit beta-1 OS=Mus musculus OX=10090 GN=Lamb1 PE=1 SV=3
13	Q8JHV7	0.52	34.7	1785	0.161	0.027	Q8JHV7_DANRE Laminin beta 1 OS=Danio rerio OX=7955 GN=lamb1 PE=1 SV=1
14	Q382P4	0.61	34.3	1299	0.137	0.032	Q382P4_TRYB2 IF rod domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.52.0008 PE=4 SV=1
15	Q57U93	0.96	33.5	577	0.214	0.111	Q57U93_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.590 PE=4 SV=1
16	Q90XD7	2.1	32.3	659	0.157	0.071	Q90XD7_DANRE Lamin OS=Danio rerio OX=7955 GN=wu:fk66d12 PE=1 SV=1
17	B3DKC5	2.3	32.3	659	0.157	0.071	B3DKC5_DANRE Lamin A OS=Danio rerio OX=7955 GN=cb948 PE=1 SV=1
18	Q08144	2.4	32.0	397	0.084	0.063	TLG2_YEAST t-SNARE affecting a late Golgi compartment protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TLG2 PE=1 SV=1
19	Q1RMR3	3.9	31.6	538	0.114	0.063	Q1RMR3_BOVIN Cortactin OS=Bos taurus OX=9913 GN=CTTN PE=1 SV=1
20	Q00799	5.5	31.2	2867	0.110	0.012	RBP2_PLAVB Reticulocyte-binding protein 2 OS=Plasmodium vivax (strain Belem) OX=31273 GN=RBP-2 PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15294 Leu_zip	3.7e-124	425.3	Leucine zipper
2	PF17107 SesA	1.7e+02	13.8	N-terminal domain on NACHT_NTPase and P-loop NTPases

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296135

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000242067	0.992	Protein PTHB1
2	9606.ENSP00000295240	0.990	Bardet-Biedl syndrome 5 protein
3	9606.ENSP00000264499	0.986	Bardet-Biedl syndrome 7 protein
4	9606.ENSP00000245157	0.979	Bardet-Biedl syndrome 2 protein
5	9606.ENSP00000268057	0.979	Bardet-Biedl syndrome 4 protein
6	9606.ENSP00000317469	0.979	Bardet-Biedl syndrome 1 protein
7	9606.ENSP00000482306	0.975	Tetratricopeptide repeat protein 8
8	9606.ENSP00000480971	0.944	Somatostatin receptor type 3
9	9606.ENSP00000249373	0.934	Smoothened homolog
10	9606.ENSP00000249016	0.917	Melanin-concentrating hormone receptor 1
11	9606.ENSP00000337722	0.908	ADP-ribosylation factor-like protein 6
12	9606.ENSP00000433157	0.855	BBSome interacting protein 1
13	9606.ENSP00000438273	0.816	Bardet-Biedl syndrome 12 protein
14	9606.ENSP00000376946	0.801	Bardet-Biedl syndrome 10 protein
15	9606.ENSP00000393541	0.770	Intraflagellar transport protein 27 homolog
16	9606.ENSP00000355499	0.713	Serologically defined colon cancer antigen 8
17	9606.ENSP00000259469	0.655	60S ribosomal protein L35
18	9606.ENSP00000389998	0.654	Meckelin
19	9606.ENSP00000379506	0.633	60S ribosomal protein L14
20	9606.ENSP00000313169	0.632	Nephrocystin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0062063	0.941	BBSome binding
GO:0042802	0.676	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.923	cellular process
GO:0048523	0.831	negative regulation of cellular process
GO:1905475	0.751	regulation of protein localization to membrane
GO:1904375	0.738	regulation of protein localization to cell periphery
GO:1903828	0.472	negative regulation of protein localization
GO:0032501	0.377	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.991	cytosol
GO:0043229	0.990	intracellular organelle
GO:0043227	0.983	membrane-bounded organelle
GO:0042995	0.868	cell projection
GO:0120025	0.846	plasma membrane bounded cell projection
GO:0005634	0.840	nucleus
GO:0043228	0.839	non-membrane-bounded organelle
GO:0043232	0.828	intracellular non-membrane-bounded organelle
GO:0005929	0.759	cilium
GO:0016020	0.753	membrane
GO:0005856	0.675	cytoskeleton
GO:0015630	0.437	microtubule cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]