StarFunc result for job id Q9NQ75

User Input

>input (786 residues)
MKGTGIMDCAPKALLARALYDNCPDCSDELAFSRGDILTILEQHVPESEGWWKCLLHGRQ
GLAPANRLQILTEVAADRPCPPFLRGLEEAPASSEETYQVPTLPRPPTPGPVYEQMRSWA
EGPQPPTAQVYEFPDPPTSARIICEKTLSFPKQAILTLPRPVRASLPTLPSQVYDVPTQH
RGPVVLKEPEKQQLYDIPASPKKAGLHPPDSQASGQGVPLISVTTLRRGGYSTLPNPQKS
EWIYDTPVSPGKASVRNTPLTSFAEESRPHALPSSSSTFYNPPSGRSRSLTPQLNNNVPM
QKKLSLPEIPSYGFLVPRGTFPLDEDVSYKVPSSFLIPRVEQQNTKPNIYDIPKATSSVS
QAGKELEKAKEVSENSAGHNSSWFSRRTTSPSPEPDRLSGSSSDSRASIVSSCSTTSTDD
SSSSSSEESAKELSLDLDVAKETVMALQHKVVSSVAGLMLFVSRKWRFRDYLEANIDAIH
RSTDHIEESVREFLDFARGVHGTACNLTDSNLQNRIRDQMQTISNSYRILLETKESLDNR
NWPLEVLVTDSVQNSPDDLERFVMVARMLPEDIKRFASIVIANGRLLFKRNCEKEETVQL
TPNAEFKCEKYIQPPQRETESHQKSTPSTKQREDEHSSELLKKNRANICGQNPGPLIPQP
SSQQTPERKPRLSEHCRLYFGALFKAISAFHGSLSSSQPAEIITQSKLVIMVGQKLVDTL
CMETQERDVRNEILRGSSHLCSLLKDVALATKNAVLTYPSPAALGHLQAEAEKLEQHTRQ
FRGTLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQ75	1.000	1.000	2.278E-91	786	1.000	1.000	Q9NQ75.pdb.gz	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
2	AFDB:F1NW90	0.207	0.198	6.668E-32	823	0.296	0.283	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
3	AFDB:A0A024QZV9	0.222	0.209	1.885E-31	834	0.275	0.259	A0A024QZV9.pdb.gz
4	AFDB:O35177	0.216	0.205	8.006E-31	833	0.262	0.247	O35177.pdb.gz	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
5	AFDB:A4IJ58	0.212	0.201	2.002E-24	831	0.229	0.217	A4IJ58.pdb.gz	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
6	AFDB:Q64355	0.141	0.191	9.986E-12	560	0.130	0.182	Q64355.pdb.gz	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
7	AFDB:Q9VA36	0.086	0.077	1.107E-5	882	0.148	0.132	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
8	AFDB:A0A0B4KI34	0.092	0.078	4.295E-5	941	0.153	0.128	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
9	AFDB:Q9VMA7	0.073	0.040	1.161E-4	1430	0.118	0.065	Q9VMA7.pdb.gz	TGO1_DROME Transport and Golgi organization protein 1 OS=Drosophila melanogaster OX=7227 GN=Tango1 PE=1 SV=2
10	AFDB:Q54DW4	0.074	0.054	1.391E-4	1350	0.148	0.086	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
11	PDB:3ehqA	0.070	0.286	1.217E-3	182	0.027	0.115	3ehqA.pdb.gz
12	PDB:1k9aB	0.072	0.127	1.828E-3	441	0.027	0.048	1k9aB.pdb.gz
13	PDB:1griA	0.079	0.286	2.190E-3	211	0.024	0.090	1griA.pdb.gz
14	PDB:3qwyA	0.072	0.323	4.314E-3	170	0.022	0.100	3qwyA.pdb.gz
15	PDB:2lqnA	0.071	0.178	4.513E-3	303	0.023	0.059	2lqnA.pdb.gz
16	PDB:6nr7A	0.103	0.079	5.919E-3	1086	0.048	0.035	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
17	PDB:1tr2B	0.145	0.114	6.478E-3	1029	0.031	0.023	1tr2B.pdb.gz
18	PDB:2dybA	0.073	0.189	6.478E-3	298	0.022	0.057	2dybA.pdb.gz
19	PDB:6fuyA	0.133	0.112	6.778E-3	961	0.028	0.023	6fuyA.pdb.gz
20	PDB:7ktuA	0.144	0.116	1.114E-2	995	0.032	0.025	7ktuA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQ75	0.0	1616	786	1.000	1.000	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
2	F1NW90	1.69e-74	260	823	0.324	0.310	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
3	Q14511	2.33e-67	241	834	0.313	0.295	CASL_HUMAN Enhancer of filamentation 1 OS=Homo sapiens OX=9606 GN=NEDD9 PE=1 SV=1
4	O35177	2.54e-67	241	833	0.304	0.287	CASL_MOUSE Enhancer of filamentation 1 OS=Mus musculus OX=10090 GN=Nedd9 PE=1 SV=2
5	A0A8I3PDQ1	6.74e-51	193	834	0.235	0.222	CASL_CANLF Enhancer of filamentation 1 OS=Canis lupus familiaris OX=9615 GN=NEDD9 PE=1 SV=1
6	Q63767	8.64e-46	179	968	0.300	0.244	BCAR1_RAT Breast cancer anti-estrogen resistance protein 1 OS=Rattus norvegicus OX=10116 GN=Bcar1 PE=1 SV=1
7	Q61140	9.49e-45	175	874	0.299	0.269	BCAR1_MOUSE Breast cancer anti-estrogen resistance protein 1 OS=Mus musculus OX=10090 GN=Bcar1 PE=1 SV=2
8	A0A087WUD2	3.76e-41	163	685	0.156	0.180	A0A087WUD2_HUMAN Neural precursor cell expressed, developmentally down-regulated 9 OS=Homo sapiens OX=9606 GN=NEDD9 PE=1 SV=1
9	Q6P5Z4	1.39e-29	128	870	0.218	0.197	Q6P5Z4_HUMAN Breast cancer anti-estrogen resistance 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=2 SV=1
10	P56945	1.34e-27	122	870	0.215	0.194	BCAR1_HUMAN Breast cancer anti-estrogen resistance protein 1 OS=Homo sapiens OX=9606 GN=BCAR1 PE=1 SV=2
11	Q9YHC0	3.18e-22	100	316	0.098	0.244	Q9YHC0_CHICK Enhancer of filamentation 1 homolog (Fragment) OS=Gallus gallus OX=9031 PE=2 SV=1
12	A4IJ58	1.65e-19	96.3	831	0.108	0.102	A4IJ58_DROME IP17195p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=1 SV=1
13	B7Z0H1	2.04e-19	95.1	567	0.108	0.150	B7Z0H1_DROME P130CAS, isoform E OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=4 SV=1
14	Q95U71	2.14e-19	95.1	568	0.108	0.150	Q95U71_DROME GH02705p OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=2 SV=1
15	Q7KVE5	2.41e-19	95.5	793	0.108	0.107	Q7KVE5_DROME Crk-associated substrate OS=Drosophila melanogaster OX=7227 GN=p130CAS PE=2 SV=1
16	Q64355	2.27e-12	72.8	560	0.057	0.080	EFS_MOUSE Embryonal Fyn-associated substrate OS=Mus musculus OX=10090 GN=Efs PE=1 SV=2
17	O43281	1.37e-10	67.0	561	0.042	0.059	EFS_HUMAN Embryonal Fyn-associated substrate OS=Homo sapiens OX=9606 GN=EFS PE=1 SV=1
18	P34109	1.09e-07	58.2	1109	0.038	0.027	MYOD_DICDI Myosin ID heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoD PE=1 SV=2
19	Q90748	5.00e-07	55.8	1099	0.036	0.025	Q90748_CHICK Brush border myosin IB OS=Gallus gallus OX=9031 GN=CBBMIB PE=2 SV=1
20	Q62420	1.64e-06	53.5	352	0.031	0.068	SH3G2_MOUSE Endophilin-A1 OS=Mus musculus OX=10090 GN=Sh3gl2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12026 CAS_C	1.4e-44	164.1	Crk-Associated Substrate C-terminal domain
2	PF05147 LANC_like	1.7e+02	12.1	Lanthionine synthetase C-like protein
3	PF08824 Serine_rich	1.1e-57	206.0	Serine rich protein interaction domain
4	PF00018 SH3_1	7.4e-06	36.8	SH3 domain
5	PF07653 SH3_2	0.012	26.8	Variant SH3 domain
6	PF14604 SH3_9	5.4e-08	44.0	Variant SH3 domain
7	PF08941 USP8_interact	2.4e+02	12.9	USP8 interacting

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353462

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000199447	0.836	Thioredoxin domain-containing protein 3
2	9606.ENSP00000381109	0.819	Zinc finger CW-type and PWWP domain containing 1
3	9606.ENSP00000405338	0.784	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
4	9606.ENSP00000342858	0.756	Fermitin family homolog 2
5	9606.ENSP00000216487	0.740	Ras and Rab interactor 3
6	9606.ENSP00000431840	0.724	Sodium/potassium/calcium exchanger 4
7	9606.ENSP00000263094	0.717	ATP-binding cassette sub-family A member 7
8	9606.ENSP00000377015	0.710	Phosphatidylinositol-binding clathrin assembly protein
9	9606.ENSP00000260197	0.707	Sortilin-related receptor
10	9606.ENSP00000435926	0.705	CUGBP Elav-like family member 1
11	9606.ENSP00000352264	0.695	CD2-associated protein
12	9606.ENSP00000316779	0.693	Myc box-dependent-interacting protein 1
13	9606.ENSP00000380638	0.693	Protein-tyrosine kinase 2-beta
14	9606.ENSP00000364114	0.690	HLA class II histocompatibility antigen, DR beta 5 chain
15	9606.ENSP00000392770	0.688	Membrane-spanning 4-domains subfamily A member 6A
16	9606.ENSP00000275815	0.661	Ephrin type-A receptor 1
17	9606.ENSP00000449629	0.640	Ankyrin repeat and sterile alpha motif domain-containing protein 1B
18	9606.ENSP00000217109	0.636	Cleavage stimulation factor subunit 1
19	9606.ENSP00000340874	0.631	Myocyte-specific enhancer factor 2C
20	9606.ENSP00000284885	0.627	Enteropeptidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990782	1.000	protein tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048522	0.986	positive regulation of cellular process
GO:0023056	0.962	positive regulation of signaling
GO:0010647	0.957	positive regulation of cell communication
GO:0010811	0.952	positive regulation of cell-substrate adhesion
GO:0065009	0.931	regulation of molecular function
GO:0019222	0.924	regulation of metabolic process
GO:1902531	0.915	regulation of intracellular signal transduction
GO:0031323	0.910	regulation of cellular metabolic process
GO:0051247	0.908	positive regulation of protein metabolic process
GO:0043085	0.901	positive regulation of catalytic activity
GO:0009967	0.899	positive regulation of signal transduction
GO:0040012	0.886	regulation of locomotion
GO:0031325	0.884	positive regulation of cellular metabolic process
GO:0051347	0.881	positive regulation of transferase activity
GO:2000145	0.877	regulation of cell motility
GO:0009987	0.875	cellular process
GO:0045859	0.869	regulation of protein kinase activity
GO:0042327	0.858	positive regulation of phosphorylation
GO:0031401	0.843	positive regulation of protein modification process
GO:0033674	0.843	positive regulation of kinase activity
GO:1902533	0.823	positive regulation of intracellular signal transduction
GO:0030334	0.802	regulation of cell migration
GO:0061098	0.801	positive regulation of protein tyrosine kinase activity
GO:0030335	0.625	positive regulation of cell migration
GO:0050896	0.539	response to stimulus
GO:0051716	0.459	cellular response to stimulus
GO:0048519	0.422	negative regulation of biological process
GO:1900024	0.401	regulation of substrate adhesion-dependent cell spreading
GO:1900026	0.391	positive regulation of substrate adhesion-dependent cell spreading
GO:0007154	0.385	cell communication
GO:0071840	0.360	cellular component organization or biogenesis
GO:0051896	0.360	regulation of protein kinase B signaling
GO:0007165	0.355	signal transduction
GO:0016043	0.350	cellular component organization
GO:0048523	0.350	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0030054	0.996	cell junction
GO:0070161	0.978	anchoring junction
GO:0005925	0.971	focal adhesion
GO:0043226	0.959	organelle
GO:0043229	0.954	intracellular organelle
GO:0016020	0.951	membrane
GO:0071944	0.927	cell periphery
GO:0043227	0.925	membrane-bounded organelle
GO:0043231	0.921	intracellular membrane-bounded organelle
GO:0005886	0.917	plasma membrane
GO:0005634	0.557	nucleus
GO:0070013	0.502	intracellular organelle lumen
GO:0031981	0.454	nuclear lumen
GO:0005654	0.411	nucleoplasm
GO:0005829	0.313	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]