StarFunc result for job id Q9NQ87

User Input

>input (328 residues)
MKRPKEPSGSDGESDGPIDVGQEGQLSQMARPLSTPSSSQMQARKKHRGIIEKRRRDRIN
SSLSELRRLVPTAFEKQGSSKLEKAEVLQMTVDHLKMLHATGGTGFFDARALAVDFRSIG
FRECLTEVIRYLGVLEGPSSRADPVRIRLLSHLNSYAAEMEPSPTPTGPLAFPAWPWSFF
HSCPGLPALSNQLAILGRVPSPVLPGVSSPAYPIPALRTAPLRRATGIILPARRNVLPSR
GASSTRRARPLERPATPVPVAPSSRAARSSHIAPLLQSSSPTPPGPTGSAAYVAVPTPNS
SSPGPAGRPAGAMLYHSWVSEITEIGAF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQ87	0.999	0.999	1.691E-44	328	1.000	1.000	Q9NQ87.pdb.gz	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
2	AFDB:Q9DBX7	0.551	0.553	5.354E-34	326	0.777	0.782	Q9DBX7.pdb.gz	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
3	AFDB:Q9I8A3	0.393	0.433	1.023E-16	294	0.442	0.493	Q9I8A3.pdb.gz	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
4	AFDB:Q8AXV6	0.353	0.364	1.087E-16	317	0.448	0.464	Q8AXV6.pdb.gz	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
5	AFDB:Q9I9L0	0.361	0.365	1.878E-16	324	0.427	0.432	Q9I9L0.pdb.gz	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
6	AFDB:Q7KM13	0.219	0.172	1.344E-11	425	0.338	0.261	Q7KM13.pdb.gz	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
7	AFDB:Q2PGD2	0.185	0.146	3.220E-7	421	0.226	0.176	Q2PGD2.pdb.gz	Q2PGD2_DANRE BHLH protein DEC2 OS=Danio rerio OX=7955 GN=bhlhb3l PE=2 SV=1
8	AFDB:Q0D311	0.182	0.150	2.541E-6	403	0.223	0.181	Q0D311.pdb.gz	Q0D311_DANRE Basic-helix-loop-helix protein OS=Danio rerio OX=7955 GN=dec1 PE=2 SV=1
9	AFDB:Q26263	0.203	0.160	5.947E-6	435	0.244	0.184	Q26263.pdb.gz	DPN_DROME Protein deadpan OS=Drosophila melanogaster OX=7227 GN=dpn PE=1 SV=2
10	AFDB:O35779	0.184	0.149	9.099E-6	410	0.262	0.210	O35779.pdb.gz	BHE41_RAT Class E basic helix-loop-helix protein 41 OS=Rattus norvegicus OX=10116 GN=Bhlhb3 PE=2 SV=2
11	PDB:5mrcR	0.103	0.103	1.443	331	0.073	0.073	5mrcR.pdb.gz	The structure of the yeast mitochondrial ribosome.
12	PDB:1zylA	0.127	0.128	1.955	325	0.049	0.049	1zylA.pdb.gz
13	PDB:7z36B	0.168	0.129	3.178	446	0.064	0.047	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
14	PDB:7suk5	0.129	0.140	3.377	296	0.055	0.061	7suk5.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:3hefB	0.124	0.272	3.813	130	0.058	0.146	3hefB.pdb.gz
16	PDB:6n63A	0.126	0.265	3.813	141	0.049	0.113	6n63A.pdb.gz	Large protein organelles form a new iron sequestration system with high storage capacity.
17	PDB:3c3wA	0.146	0.215	4.052	211	0.027	0.043	3c3wA.pdb.gz
18	PDB:3sjaB	0.115	0.111	4.306	341	0.058	0.056	3sjaB.pdb.gz	Structural basis for tail-anchored membrane protein biogenesis by the Get3-receptor complex.
19	PDB:4v8mAG	0.107	0.174	4.306	141	0.061	0.142	4v8mAG.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:1kmiZ	0.152	0.252	4.576	177	0.061	0.113	1kmiZ.pdb.gz	Structure and catalytic mechanism of the E. coli chemotaxis phosphatase CheZ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQ87	0.0	650	328	1.000	1.000	HEYL_HUMAN Hairy/enhancer-of-split related with YRPW motif-like protein OS=Homo sapiens OX=9606 GN=HEYL PE=1 SV=2
2	Q9DBX7	3.28e-175	490	326	0.777	0.782	HEYL_MOUSE Hairy/enhancer-of-split related with YRPW motif-like protein OS=Mus musculus OX=10090 GN=Heyl PE=1 SV=2
3	Q9I8A3	3.31e-70	222	294	0.457	0.510	HEY1_XENLA Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Xenopus laevis OX=8355 GN=hey1 PE=1 SV=1
4	Q9UBP5	2.81e-67	216	337	0.335	0.326	HEY2_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Homo sapiens OX=9606 GN=HEY2 PE=1 SV=1
5	Q9I9L0	3.35e-67	215	324	0.341	0.346	HEY2_DANRE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Danio rerio OX=7955 GN=hey2 PE=2 SV=2
6	Q9Y5J3	7.73e-67	214	304	0.338	0.365	HEY1_HUMAN Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Homo sapiens OX=9606 GN=HEY1 PE=1 SV=1
7	Q9WV93	1.65e-66	213	299	0.335	0.368	HEY1_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Mus musculus OX=10090 GN=Hey1 PE=1 SV=1
8	Q9QUS4	3.40e-66	213	339	0.335	0.324	HEY2_MOUSE Hairy/enhancer-of-split related with YRPW motif protein 2 OS=Mus musculus OX=10090 GN=Hey2 PE=1 SV=1
9	G3V7S6	3.47e-66	213	339	0.335	0.324	G3V7S6_RAT Hes-related family bHLH transcription factor with YRPW motif 2 OS=Rattus norvegicus OX=10116 GN=Hey2 PE=4 SV=1
10	Q8AXV6	2.13e-64	208	317	0.323	0.334	HEY1_DANRE Hairy/enhancer-of-split related with YRPW motif protein 1 OS=Danio rerio OX=7955 GN=hey1 PE=2 SV=1
11	A0A8I5ZYX7	2.03e-63	213	617	0.338	0.180	A0A8I5ZYX7_RAT Hes-related family bHLH transcription factor with YRPW motif 1 OS=Rattus norvegicus OX=10116 GN=Hey1 PE=4 SV=1
12	Q7KM13	9.92e-42	152	425	0.223	0.172	HEY_DROME Hairy/enhancer-of-split related with YRPW motif protein OS=Drosophila melanogaster OX=7227 GN=Hey PE=2 SV=1
13	Q9DF41	1.32e-21	94.7	291	0.207	0.234	Q9DF41_DANRE BHLH-WRPW transcription factor OS=Danio rerio OX=7955 GN=wu:fc30a03 PE=2 SV=1
14	Q90VV1	5.19e-21	92.8	277	0.155	0.184	HES4B_XENLA Transcription factor HES-4-B OS=Xenopus laevis OX=8355 GN=hes4-b PE=1 SV=1
15	Q6PBX3	6.35e-21	92.4	270	0.155	0.189	Q6PBX3_DANRE Hairy-related 6 OS=Danio rerio OX=7955 GN=HER-6 PE=2 SV=1
16	Q7TS99	2.00e-20	90.5	240	0.216	0.296	HELT_MOUSE Hairy and enhancer of split-related protein HELT OS=Mus musculus OX=10090 GN=Helt PE=1 SV=1
17	Q6XLQ0	4.50e-20	90.5	290	0.223	0.252	Q6XLQ0_CHICK C-hairy1A OS=Gallus gallus OX=9031 GN=hairy1 PE=1 SV=1
18	Q90Z12	6.13e-20	90.1	281	0.152	0.178	HES4A_XENLA Transcription factor HES-4-A OS=Xenopus laevis OX=8355 GN=hes4-a PE=1 SV=2
19	Q6IRB2	6.85e-20	89.7	267	0.155	0.191	HES1A_XENLA Transcription factor HES-1-A OS=Xenopus laevis OX=8355 GN=hes1-a PE=1 SV=1
20	Q04666	8.95e-20	89.7	281	0.155	0.181	HES1_RAT Transcription factor HES-1 OS=Rattus norvegicus OX=10116 GN=Hes1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07527 Hairy_orange	1.3e-06	39.8	Hairy Orange
2	PF00010 HLH	2.7e-13	61.0	Helix-loop-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361943

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000277541	0.971	Neurogenic locus notch homolog protein 1
2	9606.ENSP00000263388	0.969	Neurogenic locus notch homolog protein 3
3	9606.ENSP00000345206	0.967	Recombining binding protein suppressor of hairless
4	9606.ENSP00000292599	0.942	Mastermind-like protein 1
5	9606.ENSP00000414517	0.930	Mastermind-like domain-containing protein 1
6	9606.ENSP00000357348	0.915	Hairy/enhancer-of-split related with YRPW motif protein 2
7	9606.ENSP00000434552	0.913	Mastermind-like protein 2
8	9606.ENSP00000338272	0.912	Hairy/enhancer-of-split related with YRPW motif protein 1
9	9606.ENSP00000421180	0.912	Mastermind-like protein 3
10	9606.ENSP00000261531	0.911	SNW domain-containing protein 1
11	9606.ENSP00000263253	0.909	Histone acetyltransferase p300
12	9606.ENSP00000263754	0.905	Histone acetyltransferase KAT2B
13	9606.ENSP00000225916	0.902	Histone acetyltransferase KAT2A
14	9606.ENSP00000262367	0.901	CREB-binding protein
15	9606.ENSP00000254958	0.732	Protein jagged-1
16	9606.ENSP00000232424	0.691	Transcription factor HES-1
17	9606.ENSP00000256646	0.676	Neurogenic locus notch homolog protein 2
18	9606.ENSP00000328169	0.675	Protein jagged-2
19	9606.ENSP00000355718	0.654	Delta-like protein 1
20	9606.ENSP00000249749	0.653	Delta-like protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001227	0.999	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0003677	0.992	DNA binding
GO:0043565	0.980	sequence-specific DNA binding
GO:0019904	0.963	protein domain specific binding
GO:0003690	0.956	double-stranded DNA binding
GO:1990837	0.954	sequence-specific double-stranded DNA binding
GO:0008134	0.742	transcription factor binding
GO:0140297	0.564	DNA-binding transcription factor binding
GO:0046983	0.335	protein dimerization activity
GO:0050683	0.303	AF-1 domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050896	0.988	response to stimulus
GO:0048856	0.988	anatomical structure development
GO:0006355	0.988	regulation of DNA-templated transcription
GO:0048519	0.987	negative regulation of biological process
GO:0048523	0.983	negative regulation of cellular process
GO:0051716	0.981	cellular response to stimulus
GO:0032501	0.979	multicellular organismal process
GO:0010557	0.978	positive regulation of macromolecule biosynthetic process
GO:0031328	0.978	positive regulation of cellular biosynthetic process
GO:0007275	0.973	multicellular organism development
GO:0009892	0.971	negative regulation of metabolic process
GO:0051254	0.971	positive regulation of RNA metabolic process
GO:0007165	0.970	signal transduction
GO:0006357	0.968	regulation of transcription by RNA polymerase II
GO:0010605	0.963	negative regulation of macromolecule metabolic process
GO:0007166	0.946	cell surface receptor signaling pathway
GO:0051172	0.938	negative regulation of nitrogen compound metabolic process
GO:0031324	0.938	negative regulation of cellular metabolic process
GO:0003179	0.938	heart valve morphogenesis
GO:0007219	0.933	Notch signaling pathway
GO:0051253	0.933	negative regulation of RNA metabolic process
GO:0045892	0.923	negative regulation of DNA-templated transcription
GO:0045893	0.902	positive regulation of DNA-templated transcription
GO:0030154	0.885	cell differentiation
GO:0003197	0.873	endocardial cushion development
GO:0060317	0.873	cardiac epithelial to mesenchymal transition
GO:0045944	0.867	positive regulation of transcription by RNA polymerase II
GO:1905314	0.861	semi-lunar valve development
GO:0072132	0.812	mesenchyme morphogenesis
GO:0048646	0.672	anatomical structure formation involved in morphogenesis
GO:0003203	0.591	endocardial cushion morphogenesis
GO:0000122	0.525	negative regulation of transcription by RNA polymerase II
GO:0009966	0.374	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.883	cytoplasm
GO:0032991	0.360	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]