StarFunc result for job id Q9NQ88

User Input

>input (270 residues)
MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLM
RTKQTMHGILERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPP
GGETLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKV
NSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFII
NFEEGREVKPTVQCICMNLQDHLNGLTETR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQ88	1.000	1.000	2.959E-61	270	1.000	1.000	Q9NQ88.pdb.gz	TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1
2	PDB:3dcyA	0.890	0.973	2.275E-48	247	0.893	0.976	3dcyA.pdb.gz
3	AFDB:Q8BZA9	0.945	0.949	4.453E-47	269	0.722	0.725	Q8BZA9.pdb.gz	TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus OX=10090 GN=Tigar PE=1 SV=1
4	AFDB:Q7ZVE3	0.796	0.834	8.459E-29	257	0.381	0.401	Q7ZVE3.pdb.gz	TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio OX=7955 GN=tigarb PE=1 SV=2
5	PDB:3e9dA	0.782	0.842	1.202E-27	250	0.381	0.412	3e9dA.pdb.gz
6	PDB:3e9cA	0.593	0.778	4.319E-19	204	0.300	0.397	3e9cA.pdb.gz
7	PDB:6s2rA	0.605	0.692	2.005E-15	234	0.222	0.256	6s2rA.pdb.gz
8	AFDB:P9WIC7	0.614	0.736	3.880E-15	223	0.222	0.269	P9WIC7.pdb.gz	GPGP_MYCTU Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gpgP PE=1 SV=1
9	AFDB:Q12040	0.620	0.722	1.055E-14	230	0.230	0.270	Q12040.pdb.gz	YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR283W PE=1 SV=1
10	AFDB:P36623	0.567	0.712	1.459E-13	211	0.219	0.280	P36623.pdb.gz	PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpm1 PE=1 SV=1
11	AFDB:F4KI56	0.643	0.724	2.406E-13	238	0.226	0.256	F4KI56.pdb.gz	SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana OX=3702 GN=IPSP PE=1 SV=1
12	AFDB:Q386L9	0.584	0.545	3.290E-13	291	0.211	0.196	Q386L9.pdb.gz	Q386L9_TRYB2 Glycerolphosphate mutase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0440 PE=4 SV=1
13	AFDB:F4I8M8	0.593	0.488	5.426E-13	332	0.211	0.172	F4I8M8.pdb.gz	GPMA2_ARATH 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 2 OS=Arabidopsis thaliana OX=3702 GN=gpmA2 PE=2 SV=1
14	AFDB:O94420	0.613	0.588	6.149E-13	282	0.207	0.199	O94420.pdb.gz	YQGD_SCHPO Probable phosphatase C1620.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1620.13 PE=3 SV=1
15	PDB:1e58A	0.535	0.581	1.719E-12	247	0.226	0.247	1e58A.pdb.gz
16	PDB:3lg2A	0.550	0.552	2.694E-11	269	0.181	0.182	3lg2A.pdb.gz	Structure and activity of the metal-independent fructose-1,6-bisphosphatase YK23 from Saccharomyces cerevisiae.
17	PDB:4embA	0.567	0.620	5.034E-11	245	0.222	0.245	4embA.pdb.gz
18	PDB:1fztA	0.543	0.680	2.559E-10	211	0.226	0.289	1fztA.pdb.gz
19	PDB:2h4zA	0.532	0.561	4.783E-10	255	0.200	0.212	2h4zA.pdb.gz	Seeing the process of histidine phosphorylation in human bisphosphoglycerate mutase.
20	PDB:1qhfA	0.517	0.577	5.770E-10	240	0.193	0.217	1qhfA.pdb.gz	Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQ88	0.0	561	270	1.000	1.000	TIGAR_HUMAN Fructose-2,6-bisphosphatase TIGAR OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1
2	A0A0U1RQD1	2.54e-158	440	211	0.781	1.000	A0A0U1RQD1_HUMAN Chromosome 12 open reading frame 5, isoform CRA_b OS=Homo sapiens OX=9606 GN=TIGAR PE=1 SV=1
3	Q8BZA9	6.58e-147	414	269	0.722	0.725	TIGAR_MOUSE Fructose-2,6-bisphosphatase TIGAR OS=Mus musculus OX=10090 GN=Tigar PE=1 SV=1
4	Q7ZVE3	2.20e-57	186	257	0.396	0.416	TIGRB_DANRE Fructose-2,6-bisphosphatase TIGAR B OS=Danio rerio OX=7955 GN=tigarb PE=1 SV=2
5	O51602	8.83e-14	71.2	248	0.259	0.282	GPMA_BORBU 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=gpmA PE=1 SV=2
6	Q12040	5.07e-11	63.2	230	0.148	0.174	YO283_YEAST Broad-specificity phosphatase YOR283W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YOR283W PE=1 SV=1
7	P36623	2.23e-10	61.2	211	0.174	0.223	PMGY_SCHPO Phosphoglycerate mutase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpm1 PE=1 SV=1
8	P9WIC7	3.70e-10	60.5	223	0.170	0.206	GPGP_MYCTU Glucosyl-3-phosphoglycerate phosphatase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=gpgP PE=1 SV=1
9	F4KI56	2.80e-09	58.2	238	0.174	0.197	SERCL_ARATH Metal-independent phosphoserine phosphatase OS=Arabidopsis thaliana OX=3702 GN=IPSP PE=1 SV=1
10	Q54NE6	4.77e-09	57.8	249	0.244	0.265	PGAM_DICDI Probable phosphoglycerate mutase OS=Dictyostelium discoideum OX=44689 GN=gpmA PE=1 SV=1
11	P62707	3.36e-08	55.5	250	0.244	0.264	GPMA_ECOLI 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Escherichia coli (strain K12) OX=83333 GN=gpmA PE=1 SV=2
12	P82612	2.58e-07	52.8	248	0.141	0.153	PMGY_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPM1 PE=1 SV=3
13	Q9CIM0	3.08e-07	52.4	233	0.244	0.283	GPMA_LACLA 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=gpmA PE=3 SV=1
14	Q59VM6	3.91e-07	52.4	261	0.241	0.249	Q59VM6_CANAL Phosphoglycerate mutase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GPM2 PE=3 SV=1
15	Q6FUX8	5.91e-07	51.6	247	0.133	0.146	Q6FUX8_CANGA Phosphoglycerate mutase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=GPM1 PE=3 SV=1
16	O94461	8.45e-07	50.8	209	0.144	0.187	YFFL_SCHPO Probable phosphatase C1687.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1687.21 PE=3 SV=1
17	Q7T3G4	1.06e-06	50.8	255	0.226	0.239	Q7T3G4_DANRE Phosphoglycerate mutase OS=Danio rerio OX=7955 GN=zgc:63876 PE=1 SV=1
18	Q6P6G4	1.10e-06	50.8	258	0.237	0.248	Q6P6G4_RAT Phosphoglycerate mutase OS=Rattus norvegicus OX=10116 GN=Bpgm PE=1 SV=1
19	P15327	1.11e-06	50.8	259	0.244	0.255	PMGE_MOUSE Bisphosphoglycerate mutase OS=Mus musculus OX=10090 GN=Bpgm PE=1 SV=2
20	Q9VAN7	1.48e-06	50.4	255	0.230	0.243	Q9VAN7_DROME Phosphoglycerate mutase OS=Drosophila melanogaster OX=7227 GN=Pglym78 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00300 His_Phos_1	1.8e-29	114.3	Histidine phosphatase superfamily (branch 1)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000179259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232375	0.992	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4
2	9606.ENSP00000290573	0.984	Hexokinase-2
3	9606.ENSP00000269305	0.977	Cellular tumor antigen p53
4	9606.ENSP00000443319	0.969	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3
5	9606.ENSP00000356047	0.965	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
6	9606.ENSP00000364145	0.952	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1
7	9606.ENSP00000345771	0.923	ATP-dependent 6-phosphofructokinase, muscle type
8	9606.ENSP00000318318	0.915	Mannose-6-phosphate isomerase
9	9606.ENSP00000444433	0.862	Protein SCO2 homolog, mitochondrial
10	9606.ENSP00000370517	0.854	ATP-dependent 6-phosphofructokinase, platelet type
11	9606.ENSP00000269848	0.826	ATP-dependent 6-phosphofructokinase, liver type
12	9606.ENSP00000229270	0.805	Triosephosphate isomerase 1
13	9606.ENSP00000402103	0.802	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
14	9606.ENSP00000320171	0.776	Pyruvate kinase PKM
15	9606.ENSP00000310447	0.760	Glutaminase liver isoform, mitochondrial
16	9606.ENSP00000408025	0.759	Fructose-1,6-bisphosphatase 1
17	9606.ENSP00000364486	0.754	Fructose-1,6-bisphosphatase isozyme 2
18	9606.ENSP00000359991	0.710	Phosphoglycerate mutase 1
19	9606.ENSP00000292432	0.696	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
20	9606.ENSP00000346643	0.695	Putative hexokinase HKDC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050308	1.000	sugar-phosphatase activity
GO:0005515	0.999	protein binding
GO:0004331	0.952	fructose-2,6-bisphosphate 2-phosphatase activity
GO:0004083	0.406	bisphosphoglycerate 2-phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0019637	0.967	organophosphate metabolic process
GO:0006796	0.965	phosphate-containing compound metabolic process
GO:1901135	0.964	carbohydrate derivative metabolic process
GO:0050789	0.939	regulation of biological process
GO:0050794	0.881	regulation of cellular process
GO:0031323	0.872	regulation of cellular metabolic process
GO:0080090	0.858	regulation of primary metabolic process
GO:0050896	0.782	response to stimulus
GO:0051171	0.776	regulation of nitrogen compound metabolic process
GO:0048518	0.734	positive regulation of biological process
GO:0048522	0.658	positive regulation of cellular process
GO:0019219	0.627	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.620	negative regulation of biological process
GO:0044238	0.566	primary metabolic process
GO:0060255	0.528	regulation of macromolecule metabolic process
GO:0006807	0.495	nitrogen compound metabolic process
GO:0051716	0.489	cellular response to stimulus
GO:0031325	0.452	positive regulation of cellular metabolic process
GO:0010604	0.447	positive regulation of macromolecule metabolic process
GO:0048583	0.443	regulation of response to stimulus
GO:0006950	0.430	response to stress
GO:0048523	0.424	negative regulation of cellular process
GO:0065009	0.366	regulation of molecular function
GO:0044281	0.365	small molecule metabolic process
GO:0009894	0.360	regulation of catabolic process
GO:0019220	0.346	regulation of phosphate metabolic process
GO:0042221	0.332	response to chemical
GO:0034641	0.325	cellular nitrogen compound metabolic process
GO:0042325	0.323	regulation of phosphorylation
GO:0033554	0.314	cellular response to stress
GO:0031329	0.302	regulation of cellular catabolic process
GO:1901564	0.300	organonitrogen compound metabolic process
GO:0010941	0.300	regulation of cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0005829	0.995	cytosol
GO:0005739	0.994	mitochondrion
GO:0016020	0.990	membrane
GO:0005634	0.933	nucleus
GO:0031090	0.913	organelle membrane
GO:0005740	0.668	mitochondrial envelope
GO:0098588	0.667	bounding membrane of organelle
GO:0031966	0.651	mitochondrial membrane
GO:0031981	0.420	nuclear lumen
GO:0019867	0.389	outer membrane
GO:0031968	0.382	organelle outer membrane
GO:0005741	0.348	mitochondrial outer membrane
GO:0005654	0.325	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.23	1.000	sugar-phosphatase.
RHEA:17289	0.952	beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate
EC:3.1.3.46	0.952	fructose-2,6-bisphosphate 2-phosphatase.

[back to server]