StarFunc result for job id Q9NQ90

User Input

>input (1003 residues)
MATPGPRDIPLLPGSPRRLSPQAGSRGGQGPKHGQQCLKMPGPRAPGLQGGSNRDPGQPC
GGESTRSSSVINNYLDANEPVSLEARLSRMHFHDSQRKVDYVLAYHYRKRGVHLAQGFPG
HSLAIVSNGETGKEPHAGGPGDIELGPLDALEEERKEQREEFEHNLMEAGLELEKDLENK
SQGSIFVRIHAPWQVLAREAEFLKIKVPTKKEMYEIKAGGSIAKKFSAALQKLSSHLQPR
VPEHSNNKMKNLSYPFSREKMYLYNIQEKDTFFDNATRSRIVHEILKRTACSRANNTMGI
NSLIANNIYEAAYPLHDGEYDSPEDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKI
GLYFAWLGLYTSFLIPSSVIGVIVFLYGCATIEEDIPSREMCDQQNAFTMCPLCDKSCDY
WNLSSACGTAQASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEE
RAQEHSRPEYETKVREKMLKESNQSAVQKLETNTTECGDEDDEDKLTWKDRFPGYLMNFA
SILFMIALTFSIVFGVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIY
GAVAKWLTKIEVPKTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVF
DGYRMEECAPGGCLMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFRKLKDETEAGETD
SAHSKHPEQWDLDYSLEPYTGLTPEYMEMIIQFGFVTLFVASFPLAPVFALLNNVIEVRL
DAKKFVTELRRPDAVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSH
NGTLHGFVNHTLSFFNVSQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYW
FILSARLAFVIIFQNLVMFLSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKL
MDEPALRSPGGGDRSRSRAASSAPSGQSQLGSMMSSGSQHTNV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JU76	0.786	0.817	0.000	965	0.883	0.918	A0A0G2JU76.pdb.gz	A0A0G2JU76_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
2	AFDB:Q9NQ90	1.000	1.000	0.000	1003	1.000	1.000	Q9NQ90.pdb.gz	ANO2_HUMAN Anoctamin-2 OS=Homo sapiens OX=9606 GN=ANO2 PE=1 SV=2
3	AFDB:D4A915	0.818	0.789	7.228E-98	1040	0.568	0.548	D4A915.pdb.gz	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
4	AFDB:A2AHL1	0.736	0.752	5.609E-69	981	0.376	0.384	A2AHL1.pdb.gz	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
5	PDB:7zk3A	0.675	0.931	7.303E-69	721	0.464	0.645	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
6	AFDB:A0A0B4JCY1	0.714	0.653	1.376E-65	1099	0.353	0.322	A0A0B4JCY1.pdb.gz	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
7	PDB:7b5dA	0.648	0.917	2.934E-62	701	0.437	0.625	7b5dA.pdb.gz
8	AFDB:Q14AT5	0.714	0.829	5.205E-61	859	0.331	0.386	Q14AT5.pdb.gz	ANO7_MOUSE Anoctamin-7 OS=Mus musculus OX=10090 GN=Ano7 PE=1 SV=2
9	AFDB:Q6IWH7	0.726	0.778	1.396E-60	933	0.331	0.356	Q6IWH7.pdb.gz	ANO7_HUMAN Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7 PE=1 SV=2
10	PDB:8b8kA	0.676	0.909	3.841E-50	741	0.306	0.414	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
11	PDB:8b8jA	0.614	0.857	5.499E-47	709	0.293	0.415	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
12	AFDB:A1A5B4	0.642	0.815	7.235E-47	782	0.268	0.344	A1A5B4.pdb.gz	ANO9_HUMAN Anoctamin-9 OS=Homo sapiens OX=9606 GN=ANO9 PE=1 SV=3
13	PDB:8b8mB	0.610	0.887	6.291E-44	682	0.286	0.421	8b8mB.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
14	PDB:8bc0B	0.575	0.893	7.642E-42	636	0.280	0.442	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
15	PDB:6p47A	0.644	0.880	6.986E-39	725	0.297	0.411	6p47A.pdb.gz
16	PDB:8bc1A	0.499	0.936	6.292E-35	527	0.232	0.442	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
17	PDB:6bgiA	0.430	0.809	6.681E-33	510	0.372	0.731	6bgiA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.
18	PDB:6bgjA	0.413	0.795	2.346E-32	490	0.362	0.741	6bgjA.pdb.gz	Cryo-EM structures of the TMEM16A calcium-activated chloride channel.
19	AFDB:Q9HCE9	0.498	0.409	6.717E-24	1232	0.178	0.145	Q9HCE9.pdb.gz	ANO8_HUMAN Anoctamin-8 OS=Homo sapiens OX=9606 GN=ANO8 PE=1 SV=3
20	AFDB:A0A024R2S0	0.501	0.738	8.037E-24	660	0.160	0.242	A0A024R2S0.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JCY1	622	1099	0.345	0.315	A0A0B4JCY1_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
2	A0A0B4KGH4	620	950	0.345	0.364	A0A0B4KGH4_DROME Anoctamin OS=Drosophila melanogaster OX=7227 GN=subdued PE=3 SV=1
3	A0A0G2JU76	1627	903	0.838	0.931	A0A0G2JU76_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
4	A0A0G2JXB5	1792	1002	0.915	0.916	A0A0G2JXB5_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=2
5	A0A0G2K052	1165	1039	0.548	0.529	A0A0G2K052_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=2
6	A0A0G2K1M7	571	909	0.344	0.380	A0A0G2K1M7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
7	A0A8I5Y1S2	572	924	0.344	0.373	A0A8I5Y1S2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
8	A0A8I5ZNW7	1165	1040	0.549	0.530	A0A8I5ZNW7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
9	A0A8I5ZRU7	571	911	0.344	0.379	A0A8I5ZRU7_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
10	A0A8I6AA94	571	932	0.344	0.370	A0A8I6AA94_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
11	A0A8I6AHD2	571	865	0.344	0.399	A0A8I6AHD2_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
12	A0A8I6ASC3	570	888	0.344	0.389	A0A8I6ASC3_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
13	A0A8I6G530	570	887	0.344	0.389	A0A8I6G530_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano6 PE=1 SV=1
14	A0A8I6GJA0	1663	911	0.847	0.933	A0A8I6GJA0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=1
15	A0A8I6GL36	1100	990	0.529	0.536	A0A8I6GL36_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=1 SV=1
16	A2AHL1	634	981	0.370	0.378	ANO3_MOUSE Anoctamin-3 OS=Mus musculus OX=10090 GN=Ano3 PE=1 SV=1
17	D4A915	1161	1040	0.547	0.528	D4A915_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano1 PE=3 SV=1
18	F1M0A0	632	981	0.356	0.364	F1M0A0_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano3 PE=3 SV=4
19	F1M3G8	1705	936	0.869	0.932	F1M3G8_RAT Anoctamin OS=Rattus norvegicus OX=10116 GN=Ano2 PE=3 SV=3
20	Q14AT5	566	859	0.319	0.373	ANO7_MOUSE Anoctamin-7 OS=Mus musculus OX=10090 GN=Ano7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04547 Anoctamin	5.9e-153	521.7	Calcium-activated chloride channel
2	PF16178 Anoct_dimer	4.8e-81	283.3	Dimerisation domain of Ca+-activated chloride-channel, anoctamin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332413	0.849	Bestrophin-3
2	9606.ENSP00000361281	0.840	Bestrophin-4
3	9606.ENSP00000448310	0.832	Bestrophin-2
4	9606.ENSP00000399709	0.816	Bestrophin-1
5	9606.ENSP00000003084	0.770	Cystic fibrosis transmembrane conductance regulator
6	9606.ENSP00000382428	0.761	Disks large homolog 4
7	9606.ENSP00000328478	0.697	Cyclic nucleotide-gated olfactory channel
8	9606.ENSP00000365714	0.691	Protein tweety homolog 1
9	9606.ENSP00000339867	0.690	Chloride channel protein 1
10	9606.ENSP00000369251	0.651	Putative nucleotidyltransferase MAB21L1
11	9606.ENSP00000269346	0.649	Protein tweety homolog 2
12	9606.ENSP00000258796	0.643	Protein tweety homolog 3
13	9606.ENSP00000414517	0.643	Mastermind-like domain-containing protein 1
14	9606.ENSP00000421180	0.642	Mastermind-like protein 3
15	9606.ENSP00000434552	0.642	Mastermind-like protein 2
16	9606.ENSP00000369268	0.640	Cyclic nucleotide-gated cation channel alpha-4
17	9606.ENSP00000265593	0.635	Chloride channel protein 2
18	9606.ENSP00000378920	0.616	Solute carrier family 26 member 6
19	9606.ENSP00000256737	0.608	Anoctamin-3
20	9606.ENSP00000234701	0.604	Calcium-activated chloride channel regulator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005229	0.999	intracellular calcium activated chloride channel activity
GO:0022836	0.800	gated channel activity
GO:0022839	0.736	monoatomic ion gated channel activity
GO:0005244	0.350	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0051179	0.976	localization
GO:0051234	0.973	establishment of localization
GO:0006811	0.959	monoatomic ion transport
GO:0034220	0.927	monoatomic ion transmembrane transport
GO:0015698	0.718	inorganic anion transport
GO:0006821	0.698	chloride transport
GO:0065007	0.446	biological regulation
GO:0098660	0.444	inorganic ion transmembrane transport
GO:0050896	0.428	response to stimulus
GO:0050789	0.361	regulation of biological process
GO:0051716	0.355	cellular response to stimulus
GO:0050794	0.334	regulation of cellular process
GO:1902476	0.318	chloride transmembrane transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043229	0.966	intracellular organelle
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0005634	0.900	nucleus
GO:0043233	0.586	organelle lumen
GO:0070013	0.576	intracellular organelle lumen
GO:0031981	0.469	nuclear lumen
GO:0005654	0.439	nucleoplasm
GO:0005737	0.313	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	0.999	chloride(in) = chloride(out)

[back to server]