StarFunc result for job id Q9NQB0

User Input

>input (619 residues)
MPQLNGGGGDDLGANDELISFKDEGEQEEKSSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTLHFQSGSTHYSAYKTIEHQIAVQYLQMKWPLLDVQAGSLQSRQALKDARSPSP
AHIVSNKVPVVQHPHHVHPLTPLITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDIS
PYYPLSPGTVGQIPHPLGWLVPQQGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPP
HHTLHTTGIPHPAIVTPTVKQESSQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLY
MKEMRAKVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSAR
DNYGKKKKRKRDKQPGETNEHSECFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPC
RRKKKCVRYIQGEGSCLSPPSSDGSLLDSPPPSPNLLGSPPRDAKSQTEQTQPLSLSLKP
DPLAHLSMMPPPPALLLAEATHKASALCPNGALDLPPAALQPAAPSSSIAQPSTSSLHSH
SSLAGTQPQPLSLVTKSLE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQB0	0.999	0.999	1.633E-85	619	1.000	1.000	Q9NQB0.pdb.gz	TF7L2_HUMAN Transcription factor 7-like 2 OS=Homo sapiens OX=9606 GN=TCF7L2 PE=1 SV=2
2	AFDB:A0A2R8Q786	0.330	0.326	2.345E-63	630	0.838	0.824	A0A2R8Q786.pdb.gz
3	AFDB:F1Q7T6	0.224	0.227	4.760E-61	610	0.835	0.848	F1Q7T6.pdb.gz
4	AFDB:P70062	0.194	0.212	1.350E-40	554	0.596	0.666	P70062.pdb.gz	T7L1A_XENLA Transcription factor 7-like 1-A OS=Xenopus laevis OX=8355 GN=tcf7l1-a PE=1 SV=1
5	AFDB:Q9HCS4	0.206	0.215	1.923E-39	588	0.569	0.599	Q9HCS4.pdb.gz	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
6	AFDB:Q9YHE8	0.156	0.171	1.591E-38	560	0.593	0.655	Q9YHE8.pdb.gz	T7L1A_DANRE Transcription factor 7-like 1-A OS=Danio rerio OX=7955 GN=tcf7l1a PE=1 SV=1
7	AFDB:Q59DN5	0.116	0.116	5.967E-8	618	0.145	0.146	Q59DN5.pdb.gz	Q59DN5_DROME FI18025p1 OS=Drosophila melanogaster OX=7227 GN=Sox102F PE=2 SV=1
8	AFDB:Q924A2	0.131	0.037	2.373E-6	2510	0.173	0.043	Q924A2.pdb.gz	CIC_MOUSE Protein capicua homolog OS=Mus musculus OX=10090 GN=Cic PE=1 SV=2
9	AFDB:Q8CGW4	0.113	0.091	1.056E-3	782	0.170	0.134	Q8CGW4.pdb.gz	SOX30_MOUSE Transcription factor SOX-30 OS=Mus musculus OX=10090 GN=Sox30 PE=1 SV=1
10	AFDB:Q8RWY6	0.044	0.027	2.179E-3	1439	0.141	0.060	Q8RWY6.pdb.gz	CLASP_ARATH CLIP-associated protein OS=Arabidopsis thaliana OX=3702 GN=CLASP PE=1 SV=1
11	PDB:1j5nA	0.107	0.613	2.442E-2	93	0.032	0.215	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
12	PDB:7ploI	0.075	0.102	5.641E-1	451	0.018	0.024	7ploI.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
13	PDB:7aqrV	0.052	0.171	4.668	140	0.029	0.129	7aqrV.pdb.gz	A ferredoxin bridge connects the two arms of plant mitochondrial complex I.
14	PDB:7oq4Z	0.049	0.169	6.705	118	0.021	0.110	7oq4Z.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
15	PDB:6u62A	0.055	0.035	7.566	1110	0.011	0.006	6u62A.pdb.gz	Structural basis for the docking of mTORC1 on the lysosomal surface.
16	PDB:5iy7M	0.049	0.090	8.037	310	0.018	0.035	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
17	PDB:6dv9F	0.056	0.169	8.537	174	0.026	0.092	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
18	PDB:7qsmW	0.058	0.216	9.632	116	0.013	0.069	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A761	0.0	906	465	0.706	0.940	A0A8I6A761_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
2	A0A8I6A9A2	0.0	1064	652	0.943	0.896	A0A8I6A9A2_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
3	A0A8I6AGH1	0.0	1173	604	0.943	0.967	A0A8I6AGH1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
4	A0A8I6ARM6	0.0	1113	581	0.908	0.967	A0A8I6ARM6_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=1
5	D3YWT3	0.0	842	442	0.669	0.937	D3YWT3_MOUSE Transcription factor 7 like 2, T cell specific, HMG box OS=Mus musculus OX=10090 GN=Tcf7l2 PE=1 SV=1
6	D3Z9D1	0.0	1177	598	0.948	0.982	D3Z9D1_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=1 SV=4
7	D4A8X6	0.0	622	299	0.478	0.990	D4A8X6_RAT Transcription factor 7 like 2 OS=Rattus norvegicus OX=10116 GN=Tcf7l2 PE=3 SV=4
8	P70062	0.0	623	554	0.611	0.682	T7L1A_XENLA Transcription factor 7-like 1-A OS=Xenopus laevis OX=8355 GN=tcf7l1-a PE=1 SV=1
9	Q71G54	0.0	820	477	0.704	0.914	Q71G54_DANRE Transcription factor 7-like 2 OS=Danio rerio OX=7955 GN=tcf4 PE=2 SV=1
10	Q800Q5	0.0	575	551	0.595	0.668	T7L1B_DANRE Transcription factor 7-like 1-B OS=Danio rerio OX=7955 GN=tcf7l1b PE=2 SV=1
11	Q90ZB6	0.0	603	551	0.599	0.673	T7L1B_XENLA Transcription factor 7-like 1-B OS=Xenopus laevis OX=8355 GN=tcf7l1-b PE=1 SV=1
12	Q924A0	0.0	929	459	0.733	0.989	TF7L2_MOUSE Transcription factor 7-like 2 OS=Mus musculus OX=10090 GN=Tcf7l2 PE=1 SV=2
13	Q9HCS4	0.0	547	588	0.570	0.600	TF7L1_HUMAN Transcription factor 7-like 1 OS=Homo sapiens OX=9606 GN=TCF7L1 PE=1 SV=1
14	Q9NQB0	0.0	1262	619	1.000	1.000	TF7L2_HUMAN Transcription factor 7-like 2 OS=Homo sapiens OX=9606 GN=TCF7L2 PE=1 SV=2
15	Q9YHE8	0.0	571	560	0.619	0.684	T7L1A_DANRE Transcription factor 7-like 1-A OS=Danio rerio OX=7955 GN=tcf7l1a PE=1 SV=1
16	Q9Z1J1	0.0	537	584	0.556	0.589	TF7L1_MOUSE Transcription factor 7-like 1 OS=Mus musculus OX=10090 GN=Tcf7l1 PE=1 SV=2
17	P27782	1.71e-126	380	397	0.384	0.599	LEF1_MOUSE Lymphoid enhancer-binding factor 1 OS=Mus musculus OX=10090 GN=Lef1 PE=1 SV=1
18	Q9UJU2	6.04e-124	374	399	0.367	0.569	LEF1_HUMAN Lymphoid enhancer-binding factor 1 OS=Homo sapiens OX=9606 GN=LEF1 PE=1 SV=1
19	Q9QXN1	9.48e-123	370	397	0.365	0.569	LEF1_RAT Lymphoid enhancer-binding factor 1 OS=Rattus norvegicus OX=10116 GN=Lef1 PE=2 SV=1
20	O93345	4.53e-104	321	369	0.331	0.556	O93345_CHICK Lymphiod enhancer binding factor 1 OS=Gallus gallus OX=9031 GN=Lef-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08347 CTNNB1_binding	2e-90	314.0	N-terminal CTNNB1 binding
2	PF00505 HMG_box	1.2e-18	78.6	HMG (high mobility group) box
3	PF09011 HMG_box_2	9.7e-05	34.2	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9978.XP_004579871.1

Rank	PPI partner	STRING score	Description
1	9978.XP_004581440.1	0.998	Catenin beta-1 isoform X1
2	9978.XP_004593956.1	0.987	Serine/threonine-protein kinase NLK isoform X1
3	9978.XP_004577992.1	0.962	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 mRNAs, 3 Proteins
4	9978.XP_004591846.1	0.962	Upstream in-frame stop codon
5	9978.XP_004591855.1	0.962	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins
6	9978.XP_004586759.1	0.958	CREB-binding protein isoform X1
7	9978.XP_004589533.1	0.958	Histone acetyltransferase p300
8	9978.XP_004579457.1	0.937	C-terminal-binding protein 1
9	9978.XP_004593020.1	0.935	Axin-2 isoform X1
10	9978.XP_004596647.1	0.935	Axin-1 isoform X1
11	9978.XP_004579547.1	0.924	Mothers against decapentaplegic homolog 4 isoform X1
12	9978.XP_004581904.1	0.916	B-cell CLL/lymphoma 9 protein
13	9978.XP_004599405.1	0.911	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 4 Proteins
14	9978.XP_004586640.1	0.906	Adenomatous polyposis coli protein
15	9978.XP_004595975.1	0.906	Adenomatous polyposis coli protein 2
16	9978.XP_004579803.1	0.900	C-terminal-binding protein 2 isoform X1
17	9978.XP_004593835.1	0.896	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins
18	9978.XP_004599147.1	0.895	Junction plakoglobin
19	9978.XP_004591679.1	0.893	Histone deacetylase 1
20	9978.XP_004590527.1	0.870	Transcriptional enhancer factor TEF-5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990841	1.000	promoter-specific chromatin binding
GO:0005515	0.999	protein binding
GO:0003700	0.998	DNA-binding transcription factor activity
GO:0003677	0.997	DNA binding
GO:0043565	0.994	sequence-specific DNA binding
GO:1990837	0.966	sequence-specific double-stranded DNA binding
GO:0008134	0.952	transcription factor binding
GO:0000976	0.952	transcription cis-regulatory region binding
GO:0140297	0.904	DNA-binding transcription factor binding
GO:0008013	0.902	beta-catenin binding
GO:0019899	0.882	enzyme binding
GO:0000987	0.858	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.850	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061629	0.830	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019904	0.819	protein domain specific binding
GO:0019900	0.786	kinase binding
GO:0019901	0.772	protein kinase binding
GO:0000981	0.731	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0016922	0.703	nuclear receptor binding
GO:0060090	0.688	molecular adaptor activity
GO:0070016	0.538	armadillo repeat domain binding
GO:0045295	0.535	gamma-catenin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0009987	0.970	cellular process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0006109	0.965	regulation of carbohydrate metabolic process
GO:0031323	0.952	regulation of cellular metabolic process
GO:0010468	0.947	regulation of gene expression
GO:0006355	0.932	regulation of DNA-templated transcription
GO:0006357	0.918	regulation of transcription by RNA polymerase II
GO:0062012	0.889	regulation of small molecule metabolic process
GO:0048523	0.872	negative regulation of cellular process
GO:1903507	0.833	negative regulation of nucleic acid-templated transcription
GO:0010675	0.821	regulation of cellular carbohydrate metabolic process
GO:0045892	0.813	negative regulation of DNA-templated transcription
GO:0010906	0.799	regulation of glucose metabolic process
GO:0050896	0.793	response to stimulus
GO:0000122	0.788	negative regulation of transcription by RNA polymerase II
GO:0032501	0.782	multicellular organismal process
GO:0051716	0.763	cellular response to stimulus
GO:0032502	0.757	developmental process
GO:0023052	0.752	signaling
GO:0048856	0.752	anatomical structure development
GO:0007154	0.747	cell communication
GO:0043255	0.747	regulation of carbohydrate biosynthetic process
GO:0007275	0.742	multicellular organism development
GO:0045912	0.742	negative regulation of carbohydrate metabolic process
GO:0007165	0.722	signal transduction
GO:0006111	0.718	regulation of gluconeogenesis
GO:0062014	0.697	negative regulation of small molecule metabolic process
GO:0010677	0.672	negative regulation of cellular carbohydrate metabolic process
GO:0048731	0.647	system development
GO:0048513	0.481	animal organ development
GO:0048518	0.412	positive regulation of biological process
GO:0048522	0.385	positive regulation of cellular process
GO:0007267	0.369	cell-cell signaling
GO:0007166	0.359	cell surface receptor signaling pathway
GO:0010604	0.357	positive regulation of macromolecule metabolic process
GO:0016055	0.349	Wnt signaling pathway
GO:0051173	0.344	positive regulation of nitrogen compound metabolic process
GO:0031325	0.343	positive regulation of cellular metabolic process
GO:0042221	0.321	response to chemical
GO:0045935	0.315	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0032991	0.837	protein-containing complex
GO:0031981	0.435	nuclear lumen
GO:1990907	0.390	beta-catenin-TCF complex
GO:0071664	0.387	catenin-TCF7L2 complex
GO:0032993	0.386	protein-DNA complex
GO:0070369	0.383	beta-catenin-TCF7L2 complex
GO:0005737	0.316	cytoplasm
GO:0005654	0.301	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]