StarFunc result for job id Q9NQC1

User Input

>input (790 residues)
MEEKRRKYSISSDNSDTTDSHATSTSASRCSKLPSSTKSGWPRQNEKKPSEVFRTDLITA
MKIPDSYQLSPDDYYILADPWRQEWEKGVQVPAGAEAIPEPVVRILPPLEGPPAQASPSS
TMLGEGSQPDWPGGSRYDLDEIDAYWLELINSELKEMERPELDELTLERVLEELETLCHQ
NMARAIETQEGLGIEYDEDVVCDVCRSPEGEDGNEMVFCDKCNVCVHQACYGILKVPTGS
WLCRTCALGVQPKCLLCPKRGGALKPTRSGTKWVHVSCALWIPEVSIGCPEKMEPITKIS
HIPASRWALSCSLCKECTGTCIQCSMPSCVTAFHVTCAFDHGLEMRTILADNDEVKFKSF
CQEHSDGGPRNEPTSEPTEPSQAGEDLEKVTLRKQRLQQLEEDFYELVEPAEVAERLDLA
EALVDFIYQYWKLKRKANANQPLLTPKTDEVDNLAQQEQDVLYRRLKLFTHLRQDLERVR
NLCYMVTRRERTKHAICKLQEQIFHLQMKLIEQDLCRGLSTSFPIDGTFFNSWLAQSVQI
TAENMAMSEWPLNNGHREDPAPGLLSEELLQDEETLLSFMRDPSLRPGDPARKARGRTRL
PAKKKPPPPPPQDGPGSRTTPDKAPKKTWGQDAGSGKGGQGPPTRKPPRRTSSHLPSSPA
AGDCPILATPESPPPLAPETPDEAASVAADSDVQVPGPAASPKPLGRLRPPRESKVTRRL
PGARPDAGMGPPSAVAERPKVSLHFDTETDGYFSDGEMSDSDVEAEDGGVQRGPREAGAE
EVVRMGVLAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0C4DFT8	0.485	0.485	0.000	791	0.999	0.997	A0A0C4DFT8.pdb.gz	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
2	AFDB:G3XAA4	0.498	0.473	0.000	834	1.000	0.947	G3XAA4.pdb.gz	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
3	AFDB:Q6IE81	0.388	0.369	9.971E-66	842	0.513	0.481	Q6IE81.pdb.gz	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
4	AFDB:Q803A0	0.451	0.431	5.945E-62	829	0.447	0.426	Q803A0.pdb.gz	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
5	AFDB:Q92613	0.420	0.405	1.714E-60	823	0.414	0.397	Q92613.pdb.gz	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
6	AFDB:A0A0B4KGP1	0.212	0.099	2.279E-12	1717	0.151	0.069	A0A0B4KGP1.pdb.gz	A0A0B4KGP1_DROME Alhambra, isoform P OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
7	AFDB:M0RB75	0.186	0.136	1.303E-7	1099	0.132	0.095	M0RB75.pdb.gz	M0RB75_RAT [histone H3]-trimethyl-L-lysine(9) demethylase OS=Rattus norvegicus OX=10116 GN=Kdm4b PE=3 SV=1
8	AFDB:Q99PP7	0.062	0.051	6.064E-5	1142	0.151	0.104	Q99PP7.pdb.gz	TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus OX=10090 GN=Trim33 PE=1 SV=2
9	AFDB:F1LP90	0.092	0.058	7.646E-5	1336	0.113	0.067	F1LP90.pdb.gz	MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus OX=10116 GN=Mink1 PE=1 SV=2
10	AFDB:Q53KW9	0.077	0.076	1.624E-4	803	0.133	0.131	Q53KW9.pdb.gz	AM1_ORYSJ Protein AMEIOTIC 1 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=AM1 PE=1 SV=1
11	PDB:4lgwA	0.049	0.141	3.728E-1	238	0.032	0.105	4lgwA.pdb.gz
12	PDB:5d80G	0.059	0.176	1.259	223	0.034	0.121	5d80G.pdb.gz
13	PDB:7r5jH0	0.060	0.101	1.334	383	0.042	0.086	7r5jH0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
14	PDB:1yioA	0.046	0.131	2.247	198	0.020	0.081	1yioA.pdb.gz	An Active-like Structure in the Unphosphorylated StyR Response Regulator Suggests a Phosphorylation- Dependent Allosteric Activation Mechanism
15	PDB:6tdaL	0.063	0.079	2.524	596	0.047	0.062	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
16	PDB:7z36B	0.079	0.127	2.524	446	0.049	0.087	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
17	PDB:3c3wA	0.050	0.131	2.834	211	0.018	0.066	3c3wA.pdb.gz
18	PDB:6dv9F	0.043	0.157	2.834	174	0.018	0.080	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
19	PDB:6k15H	0.062	0.107	3.372	393	0.046	0.092	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
20	PDB:1l3lB	0.046	0.121	4.012	233	0.025	0.086	1l3lB.pdb.gz	Structure of a bacterial quorum-sensing transcription factor complexed with pheromone and DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X085	0.0	1602	833	1.000	0.948	A0A087X085_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
2	A0A0C4DFT8	0.0	1617	791	1.000	0.999	A0A0C4DFT8_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
3	G3XAA4	0.0	1602	834	1.000	0.947	G3XAA4_HUMAN Jade family PHD finger 2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=1
4	Q6IE81	0.0	702	842	0.535	0.502	JADE1_HUMAN Protein Jade-1 OS=Homo sapiens OX=9606 GN=JADE1 PE=1 SV=1
5	Q6ZQF7	0.0	1459	829	0.914	0.871	JADE2_MOUSE E3 ubiquitin-protein ligase Jade-2 OS=Mus musculus OX=10090 GN=Jade2 PE=1 SV=2
6	Q803A0	0.0	642	829	0.406	0.387	JADE1_DANRE Protein Jade-1 OS=Danio rerio OX=7955 GN=jade1 PE=2 SV=1
7	Q92613	0.0	607	823	0.367	0.352	JADE3_HUMAN Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1
8	Q9NQC1	0.0	1622	790	1.000	1.000	JADE2_HUMAN E3 ubiquitin-protein ligase Jade-2 OS=Homo sapiens OX=9606 GN=JADE2 PE=1 SV=2
9	Q7YZH1	1.08e-146	479	3241	0.301	0.073	RNO_DROME PHD finger protein rhinoceros OS=Drosophila melanogaster OX=7227 GN=rno PE=1 SV=1
10	Q7JVP4	7.05e-63	232	1430	0.209	0.115	BRDH_DROME Bromodomain-containing protein homolog OS=Drosophila melanogaster OX=7227 GN=Br140 PE=1 SV=1
11	D3ZUW8	2.94e-55	208	1189	0.182	0.121	D3ZUW8_RAT Bromodomain containing 1 OS=Rattus norvegicus OX=10116 GN=Brd1 PE=4 SV=3
12	G5E8P1	5.69e-55	207	1058	0.182	0.136	BRD1_MOUSE Bromodomain-containing protein 1 OS=Mus musculus OX=10090 GN=Brd1 PE=1 SV=1
13	O95696	1.09e-53	203	1058	0.180	0.134	BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens OX=9606 GN=BRD1 PE=1 SV=1
14	P55201	2.29e-53	203	1214	0.163	0.106	BRPF1_HUMAN Peregrin OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
15	A0A5F9ZH11	2.74e-53	202	1253	0.163	0.103	A0A5F9ZH11_HUMAN Bromodomain and PHD finger containing 1 OS=Homo sapiens OX=9606 GN=BRPF1 PE=1 SV=2
16	B2RRD7	3.47e-53	202	1212	0.180	0.117	BRPF1_MOUSE Peregrin OS=Mus musculus OX=10090 GN=Brpf1 PE=1 SV=1
17	Q12311	2.90e-47	182	748	0.166	0.175	NTO1_YEAST NuA3 HAT complex component NTO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NTO1 PE=1 SV=1
18	Q803M2	1.90e-45	177	899	0.110	0.097	Q803M2_DANRE Bromodomain and PHD finger containing, 1 OS=Danio rerio OX=7955 GN=zgc:55530 PE=2 SV=1
19	Q9ULD4	8.21e-45	176	1205	0.129	0.085	BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens OX=9606 GN=BRPF3 PE=1 SV=2
20	O74759	3.19e-41	164	767	0.158	0.163	NTO1_SCHPO Mst2 complex subunit nto1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nto1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	15	16.9	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF10513 EPL1	0.0057	28.7	Enhancer of polycomb-like
3	PF00628 PHD	6.5e-07	40.5	PHD-finger
4	PF13831 PHD_2	2.4e-09	47.8	PHD-finger
5	PF01503 PRA-PH	2.2e+02	13.7	Phosphoribosyl-ATP pyrophosphohydrolase
6	PF13771 zf-HC5HC2H	1.4e-20	84.7	PHD-like zinc-binding domain
7	PF13832 zf-HC5HC2H_2	9.8e-28	107.9	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354425

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259021	0.988	Histone acetyltransferase KAT7
2	9606.ENSP00000380024	0.981	Inhibitor of growth protein 4
3	9606.ENSP00000322142	0.980	Inhibitor of growth protein 5
4	9606.ENSP00000362166	0.956	Chromatin modification-related protein MEAF6
5	9606.ENSP00000320566	0.782	Inhibitor of growth protein 3
6	9606.ENSP00000262519	0.767	Histone-lysine N-methyltransferase SETD1A
7	9606.ENSP00000284000	0.652	CCAAT/enhancer-binding protein gamma
8	9606.ENSP00000251472	0.614	Microtubule-associated serine/threonine-protein kinase 1
9	9606.ENSP00000481495	0.610	ATP-dependent RNA helicase DDX24
10	9606.ENSP00000363124	0.556	PHD finger protein 20
11	9606.ENSP00000400870	0.551	Alanyl-tRNA editing protein Aarsd1
12	9606.ENSP00000356110	0.535	Nuclear casein kinase and cyclin dependent kinase substrate 1
13	9606.ENSP00000383042	0.503	Lysine-specific histone demethylase 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0140096	0.993	catalytic activity, acting on a protein
GO:0016740	0.992	transferase activity
GO:0008080	0.563	N-acetyltransferase activity
GO:0010485	0.548	histone H4 acetyltransferase activity
GO:0043997	0.333	histone H4K12 acetyltransferase activity
GO:0043996	0.333	histone H4K8 acetyltransferase activity
GO:0043995	0.333	histone H4K5 acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.991	primary metabolic process
GO:0019222	0.986	regulation of metabolic process
GO:0006807	0.981	nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0080090	0.968	regulation of primary metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0018205	0.951	peptidyl-lysine modification
GO:0051052	0.948	regulation of DNA metabolic process
GO:0016570	0.926	histone modification
GO:0043967	0.911	histone H4 acetylation
GO:0010556	0.890	regulation of macromolecule biosynthetic process
GO:0031326	0.890	regulation of cellular biosynthetic process
GO:0006275	0.887	regulation of DNA replication
GO:0051726	0.862	regulation of cell cycle
GO:2000278	0.850	regulation of DNA biosynthetic process
GO:0009987	0.661	cellular process
GO:0048518	0.520	positive regulation of biological process
GO:0048522	0.436	positive regulation of cellular process
GO:0010468	0.377	regulation of gene expression
GO:0051252	0.355	regulation of RNA metabolic process
GO:2001141	0.304	regulation of RNA biosynthetic process
GO:0009893	0.302	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.958	protein-containing complex
GO:0043232	0.958	intracellular non-membrane-bounded organelle
GO:0005737	0.495	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.992	Transferases.
EC:2.3.1.-	0.563	Transferring groups other than amino-acyl groups.
RHEA:21992	0.548	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	0.548	histone acetyltransferase.

[back to server]