StarFunc result for job id Q9NQC3

User Input

>input (1192 residues)
MEDLDQSPLVSSSDSPPRPQPAFKYQFVREPEDEEEEEEEEEEDEDEDLEELEVLERKPA
AGLSAAPVPTAPAAGAPLMDFGNDFVPPAPRGPLPAAPPVAPERQPSWDPSPVSSTVPAP
SPLSAAAVSPSKLPEDDEPPARPPPPPPASVSPQAEPVWTPPAPAPAAPPSTPAAPKRRG
SSGSVDETLFALPAASEPVIRSSAENMDLKEQPGNTISAGQEDFPSVLLETAASLPSLSP
LSAASFKEHEYLGNLSTVLPTEGTLQENVSEASKEVSEKAKTLLIDRDLTEFSELEYSEM
GSSFSVSPKAESAVIVANPREEIIVKNKDEEEKLVSNNILHNQQELPTALTKLVKEDEVV
SSEKAKDSFNEKRVAVEAPMREEYADFKPFERVWEVKDSKEDSDMLAAGGKIESNLESKV
DKKCFADSLEQTNHEKDSESSNDDTSFPSTPEGIKDRSGAYITCAPFNPAATESIATNIF
PLLGDPTSENKTDEKKIEEKKAQIVTEKNTSTKTSNPFLVAAQDSETDYVTTDNLTKVTE
EVVANMPEGLTPDLVQEACESELNEVTGTKIAYETKMDLVQTSEVMQESLYPAAQLCPSF
EESEATPSPVLPDIVMEAPLNSAVPSAGASVIQPSSSPLEASSVNYESIKHEPENPPPYE
EAMSVSLKKVSGIKEEIKEPENINAALQETEAPYISIACDLIKETKLSAEPAPDFSDYSE
MAKVEQPVPDHSELVEDSSPDSEPVDLFSDDSIPDVPQKQDETVMLVKESLTETSFESMI
EYENKEKLSALPPEGGKPYLESFKLSLDNTKDTLLPDEVSTLSKKEKIPLQMEELSTAVY
SNDDLFISKEAQIRETETFSDSSPIEIIDEFPTLISSKTDSFSKLAREYTDLEVSHKSEI
ANAPDGAGSLPCTELPHDLSLKNIQPKVEEKISFSDDFSKNGSATSKVLLLPPDVSALAT
QAEIESIVKPKVLVKEAEKKLPSDTEKEDRSPSAIFSAELSKTSVVDLLYWRDIKKTGVV
FGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQAIQKSDEGHPFRAYLESE
VAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGALFNGLTL
LILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQC3	1.000	1.000	0.000	1192	1.000	1.000	Q9NQC3.pdb.gz	RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2
2	AFDB:Q9JK11	0.198	0.202	2.365E-88	1163	0.760	0.779	Q9JK11.pdb.gz	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
3	AFDB:O95197	0.080	0.091	4.467E-17	1032	0.223	0.258	O95197.pdb.gz	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
4	AFDB:Q1W617	0.044	0.046	1.823E-2	1475	0.144	0.117	Q1W617.pdb.gz	SHRM4_MOUSE Protein Shroom4 OS=Mus musculus OX=10090 GN=Shroom4 PE=1 SV=1
5	AFDB:O70608	0.055	0.045	1.096E-1	1505	0.141	0.112	O70608.pdb.gz	SYCP2_RAT Synaptonemal complex protein 2 OS=Rattus norvegicus OX=10116 GN=Sycp2 PE=1 SV=1
6	AFDB:Q5H9F3	0.036	0.026	1.096E-1	1711	0.150	0.105	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
7	AFDB:Q9ULL8	0.064	0.055	1.160E-1	1493	0.138	0.111	Q9ULL8.pdb.gz	SHRM4_HUMAN Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4 PE=1 SV=3
8	AFDB:A0A0B4JD97	0.046	0.042	1.451E-1	1322	0.139	0.126	A0A0B4JD97.pdb.gz	A0A0B4JD97_DROME Transforming acidic coiled-coil protein, isoform K OS=Drosophila melanogaster OX=7227 GN=tacc PE=1 SV=1
9	AFDB:Q7SZL5	0.037	0.034	1.624E-1	1338	0.148	0.132	Q7SZL5.pdb.gz	MTUS1_XENLA Microtubule-associated tumor suppressor 1 homolog OS=Xenopus laevis OX=8355 GN=mtus1 PE=1 SV=1
10	AFDB:Q8N3D4	0.061	0.052	1.624E-1	1523	0.167	0.131	Q8N3D4.pdb.gz	EH1L1_HUMAN EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2
11	PDB:4o9yA	0.038	0.020	1.820	2490	0.033	0.016	4o9yA.pdb.gz
12	PDB:6z3wC	0.035	0.183	2.154	177	0.018	0.119	6z3wC.pdb.gz
13	PDB:3u44A	0.035	0.037	3.373	1122	0.017	0.018	3u44A.pdb.gz	Insights into Chi recognition from the structure of an AddAB-type helicase-nuclease complex.
14	PDB:7ungA1	0.049	0.129	3.991	391	0.033	0.100	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:7ungA3	0.048	0.144	5.909	333	0.034	0.120	7ungA3.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:2aczD	0.032	0.232	6.250	113	0.013	0.133	2aczD.pdb.gz	Structural and computational analysis of the quinone-binding site of complex II (succinate-ubiquinone oxidoreductase): a mechanism of electron transfer and proton conduction during ubiquinone reduction.
17	PDB:3b5xA	0.061	0.110	6.250	572	0.025	0.052	3b5xA.pdb.gz
18	PDB:6b2za	0.043	0.116	6.992	249	0.023	0.112	6b2za.pdb.gz	Atomic model for the dimeric FO region of mitochondrial ATP synthase.
19	PDB:7rroA1	0.041	0.113	6.992	396	0.018	0.056	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
20	PDB:7p54A	0.041	0.107	7.822	397	0.026	0.078	7p54A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99P72	0.0	1500	1162	0.747	0.767	RTN4_MOUSE Reticulon-4 OS=Mus musculus OX=10090 GN=Rtn4 PE=1 SV=2
2	Q9JK11	0.0	1461	1163	0.742	0.761	RTN4_RAT Reticulon-4 OS=Rattus norvegicus OX=10116 GN=Rtn4 PE=1 SV=1
3	Q9NQC3	0.0	2370	1192	1.000	1.000	RTN4_HUMAN Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4 PE=1 SV=2
4	Q4G5W2	1.44e-91	299	322	0.116	0.429	Q4G5W2_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
5	F1QT89	4.75e-91	293	196	0.112	0.684	F1QT89_DANRE Reticulon OS=Danio rerio OX=7955 GN=Nogo-B PE=1 SV=1
6	Q4G5V9	2.62e-90	291	212	0.112	0.632	Q4G5V9_DANRE Reticulon OS=Danio rerio OX=7955 GN=rtn4 PE=1 SV=1
7	Q6IFY7	3.09e-77	255	207	0.103	0.594	RTN1A_XENLA Reticulon-1-A OS=Xenopus laevis OX=8355 GN=rtn1-a PE=2 SV=1
8	Q2NKQ5	2.03e-75	266	702	0.109	0.185	Q2NKQ5_HUMAN Reticulon OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
9	Q16799	4.24e-75	267	776	0.109	0.168	RTN1_HUMAN Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1 PE=1 SV=1
10	Q64548	1.33e-74	266	777	0.107	0.165	RTN1_RAT Reticulon-1 OS=Rattus norvegicus OX=10116 GN=Rtn1 PE=1 SV=1
11	Q8K0T0	1.40e-74	266	780	0.107	0.164	RTN1_MOUSE Reticulon-1 OS=Mus musculus OX=10090 GN=Rtn1 PE=1 SV=1
12	O95197	2.46e-73	267	1032	0.098	0.113	RTN3_HUMAN Reticulon-3 OS=Homo sapiens OX=9606 GN=RTN3 PE=1 SV=2
13	Q6RJR6	4.02e-73	265	940	0.098	0.124	RTN3_RAT Reticulon-3 OS=Rattus norvegicus OX=10116 GN=Rtn3 PE=1 SV=1
14	Q9ES97	8.47e-73	264	964	0.098	0.121	RTN3_MOUSE Reticulon-3 OS=Mus musculus OX=10090 GN=Rtn3 PE=1 SV=2
15	Q9VMW2	1.10e-61	211	202	0.081	0.475	Q9VMW2_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
16	Q9VMW1	1.42e-61	211	224	0.080	0.424	Q9VMW1_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=2
17	Q7KTP4	1.46e-61	212	234	0.082	0.419	Q7KTP4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
18	Q9VMW4	2.34e-61	211	222	0.078	0.419	Q9VMW4_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1
19	E1JHT9	6.12e-61	209	222	0.078	0.419	E1JHT9_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=2
20	E1JHT6	1.92e-60	221	607	0.083	0.163	E1JHT6_DROME Reticulon-like protein OS=Drosophila melanogaster OX=7227 GN=Rtnl1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04842 DUF639	2.3e+02	12.6	Plant protein of unknown function (DUF639)
2	PF02453 Reticulon	3.2e-42	155.6	Reticulon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000337838

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000043402	0.999	Reticulon-4 receptor
2	9606.ENSP00000347451	0.998	Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1
3	9606.ENSP00000172229	0.996	Tumor necrosis factor receptor superfamily member 16
4	9606.ENSP00000318585	0.994	Beta-secretase 1
5	9606.ENSP00000357480	0.988	Dehydrodolichyl diphosphate synthase complex subunit NUS1
6	9606.ENSP00000247271	0.986	Oligodendrocyte-myelin glycoprotein
7	9606.ENSP00000466933	0.972	Sphingosine 1-phosphate receptor 2
8	9606.ENSP00000376048	0.969	Myelin-associated glycoprotein
9	9606.ENSP00000367050	0.960	Reticulon-3
10	9606.ENSP00000358059	0.919	Reticulon-4-interacting protein 1, mitochondrial
11	9606.ENSP00000315997	0.899	Leukocyte immunoglobulin-like receptor subfamily B member 1
12	9606.ENSP00000332979	0.894	Beta-secretase 2
13	9606.ENSP00000301522	0.885	Peroxiredoxin-2
14	9606.ENSP00000400175	0.885	Transforming protein RhoA
15	9606.ENSP00000368959	0.881	Receptor expression-enhancing protein 5
16	9606.ENSP00000245620	0.856	Leukocyte immunoglobulin-like receptor subfamily B member 3
17	9606.ENSP00000330631	0.853	Reticulon-4 receptor-like 1
18	9606.ENSP00000381844	0.827	Atlastin-3
19	9606.ENSP00000335397	0.802	Reticulon-4 receptor-like 2
20	9606.ENSP00000351155	0.802	Atlastin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.899	identical protein binding
GO:0019899	0.895	enzyme binding
GO:0043167	0.869	ion binding
GO:0046983	0.846	protein dimerization activity
GO:0097159	0.843	organic cyclic compound binding
GO:1901363	0.835	heterocyclic compound binding
GO:0050839	0.825	cell adhesion molecule binding
GO:0003676	0.802	nucleic acid binding
GO:0042803	0.800	protein homodimerization activity
GO:0043169	0.779	cation binding
GO:0045296	0.778	cadherin binding
GO:0003723	0.771	RNA binding
GO:0031625	0.764	ubiquitin protein ligase binding
GO:0046872	0.761	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0030517	0.967	negative regulation of axon extension
GO:0048522	0.962	positive regulation of cellular process
GO:0048856	0.961	anatomical structure development
GO:0032501	0.960	multicellular organismal process
GO:0007275	0.951	multicellular organism development
GO:0048731	0.926	system development
GO:0051094	0.923	positive regulation of developmental process
GO:0051240	0.903	positive regulation of multicellular organismal process
GO:0007399	0.896	nervous system development
GO:0030154	0.871	cell differentiation
GO:0060255	0.834	regulation of macromolecule metabolic process
GO:0048583	0.813	regulation of response to stimulus
GO:0050896	0.713	response to stimulus
GO:0009966	0.630	regulation of signal transduction
GO:0051171	0.617	regulation of nitrogen compound metabolic process
GO:0080090	0.613	regulation of primary metabolic process
GO:0032879	0.587	regulation of localization
GO:0006996	0.570	organelle organization
GO:0051246	0.419	regulation of protein metabolic process
GO:0030334	0.388	regulation of cell migration
GO:0009653	0.376	anatomical structure morphogenesis
GO:0048584	0.374	positive regulation of response to stimulus
GO:0051716	0.372	cellular response to stimulus
GO:0022008	0.364	neurogenesis
GO:1902531	0.358	regulation of intracellular signal transduction
GO:0010256	0.320	endomembrane system organization
GO:0009967	0.310	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.999	cell junction
GO:0005886	0.999	plasma membrane
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0005634	0.988	nucleus
GO:0031975	0.686	envelope
GO:0031967	0.684	organelle envelope
GO:0070013	0.592	intracellular organelle lumen
GO:0071782	0.469	endoplasmic reticulum tubular network
GO:0042995	0.448	cell projection
GO:0005635	0.444	nuclear envelope
GO:0005829	0.404	cytosol
GO:0098826	0.389	endoplasmic reticulum tubular network membrane
GO:0045202	0.351	synapse
GO:0032991	0.343	protein-containing complex
GO:0005654	0.319	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]