StarFunc result for job id Q9NQC7

User Input

>input (956 residues)
MSSGLWSQEKVTSPYWEERIFYLLLQECSVTDKQTQKLLKVPKGSIGQYIQDRSVGHSRI
PSAKGKKNQIGLKILEQPHAVLFVDEKDVVEINEKFTELLLAITNCEERFSLFKNRNRLS
KGLQIDVGCPVKVQLRSGEEKFPGVVRFRGPLLAERTVSGIFFGVELLEEGRGQGFTDGV
YQGKQLFQCDEDCGVFVALDKLELIEDDDTALESDYAGPGDTMQVELPPLEINSRVSLKV
GETIESGTVIFCDVLPGKESLGYFVGVDMDNPIGNWDGRFDGVQLCSFACVESTILLHIN
DIIPALSESVTQERRPPKLAFMSRGVGDKGSSSHNKPKATGSTSDPGNRNRSELFYTLNG
SSVDSQPQSKSKNTWYIDEVAEDPAKSLTEISTDFDRSSPPLQPPPVNSLTTENRFHSLP
FSLTKMPNTNGSIGHSPLSLSAQSVMEELNTAPVQESPPLAMPPGNSHGLEVGSLAEVKE
NPPFYGVIRWIGQPPGLNEVLAGLELEDECAGCTDGTFRGTRYFTCALKKALFVKLKSCR
PDSRFASLQPVSNQIERCNSLAFGGYLSEVVEENTPPKMEKEGLEIMIGKKKGIQGHYNS
CYLDSTLFCLFAFSSVLDTVLLRPKEKNDVEYYSETQELLRTEIVNPLRIYGYVCATKIM
KLRKILEKVEAASGFTSEEKDPEEFLNILFHHILRVEPLLKIRSAGQKVQDCYFYQIFME
KNEKVGVPTIQQLLEWSFINSNLKFAEAPSCLIIQMPRFGKDFKLFKKIFPSLELNITDL
LEDTPRQCRICGGLAMYECRECYDDPDISAGKIKQFCKTCNTQVHLHPKRLNHKYNPVSL
PKDLPDWDWRHGCIPCQNMELFAVLCIETSHYVAFVKYGKDDSAWLFFDSMADRDGGQNG
FNIPQVTPCPEVGEYLKMSLEDLHSLDSRRIQGCARRLLCDAYMCMYQSPTMSLYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQC7	1.000	1.000	0.000	956	1.000	1.000	Q9NQC7.pdb.gz	CYLD_HUMAN Ubiquitin carboxyl-terminal hydrolase CYLD OS=Homo sapiens OX=9606 GN=CYLD PE=1 SV=1
2	PDB:3ihpB	0.205	0.278	2.786E-8	681	0.074	0.104	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
3	PDB:5gjqx	0.204	0.476	3.111E-8	355	0.069	0.186	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
4	PDB:5mpc8	0.216	0.469	3.670E-8	395	0.068	0.165	5mpc8.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
5	PDB:7w3ax	0.215	0.385	5.108E-8	494	0.075	0.146	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
6	PDB:7qo48	0.210	0.480	4.630E-7	372	0.060	0.153	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
7	PDB:5cvnB	0.213	0.555	6.099E-7	321	0.069	0.206	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
8	PDB:3mhsA	0.201	0.384	1.182E-6	455	0.059	0.123	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
9	PDB:7yxxA	0.176	0.105	1.394E-6	1754	0.062	0.034	7yxxA.pdb.gz
10	PDB:5k16B	0.206	0.543	1.473E-6	328	0.068	0.198	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
11	PDB:4wa6D	0.182	0.370	2.701E-6	415	0.055	0.128	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
12	AFDB:Q582C5	0.167	0.163	2.234E-4	986	0.145	0.141	Q582C5.pdb.gz	Q582C5_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.3C6.500 PE=4 SV=1
13	AFDB:Q9W0L7	0.182	0.122	3.109E-4	1517	0.137	0.086	Q9W0L7.pdb.gz	Q9W0L7_DROME LD28815p OS=Drosophila melanogaster OX=7227 GN=Usp10 PE=1 SV=2
14	AFDB:A0A0G2K8Z9	0.073	0.038	3.147E-3	1843	0.069	0.036	A0A0G2K8Z9.pdb.gz	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
15	AFDB:F4JP43	0.072	0.040	9.474E-3	2037	0.074	0.035	F4JP43.pdb.gz	F4JP43_ARATH G2484-1 protein OS=Arabidopsis thaliana OX=3702 GN=G2484-1 PE=1 SV=1
16	AFDB:Q9JIR4	0.059	0.043	3.185E-2	1615	0.072	0.043	Q9JIR4.pdb.gz	RIMS1_RAT Regulating synaptic membrane exocytosis protein 1 OS=Rattus norvegicus OX=10116 GN=Rims1 PE=1 SV=1
17	AFDB:Q54DW4	0.057	0.041	6.520E-2	1350	0.065	0.046	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
18	AFDB:Q7LBC6	0.079	0.050	7.279E-2	1761	0.087	0.047	Q7LBC6.pdb.gz	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
19	AFDB:Q3LHL9	0.064	0.045	8.128E-2	1658	0.073	0.042	Q3LHL9.pdb.gz	WGE_DROME Protein winged eye OS=Drosophila melanogaster OX=7227 GN=wge PE=1 SV=1
20	AFDB:P93024	0.061	0.064	9.075E-2	902	0.096	0.102	P93024.pdb.gz	ARFE_ARATH Auxin response factor 5 OS=Arabidopsis thaliana OX=3702 GN=ARF5 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7FEV5	0.0	1280	951	0.686	0.690	E7FEV5_DANRE Ubiquitin carboxyl-terminal hydrolase CYLD OS=Danio rerio OX=7955 GN=cylda PE=1 SV=1
2	F8W5E2	0.0	1209	912	0.661	0.693	F8W5E2_DANRE Ubiquitin carboxyl-terminal hydrolase CYLD OS=Danio rerio OX=7955 GN=cylda PE=4 SV=1
3	Q80TQ2	0.0	1848	952	0.945	0.949	CYLD_MOUSE Ubiquitin carboxyl-terminal hydrolase CYLD OS=Mus musculus OX=10090 GN=Cyld PE=1 SV=2
4	Q9NQC7	0.0	1977	956	1.000	1.000	CYLD_HUMAN Ubiquitin carboxyl-terminal hydrolase CYLD OS=Homo sapiens OX=9606 GN=CYLD PE=1 SV=1
5	E7F048	7.59e-152	467	694	0.257	0.354	E7F048_DANRE Cylindromatosis (turban tumor syndrome), b OS=Danio rerio OX=7955 GN=cyldb PE=4 SV=2
6	Q8IPC3	5.41e-143	439	551	0.249	0.432	Q8IPC3_DROME Cylindromatosis, isoform B OS=Drosophila melanogaster OX=7227 GN=CYLD PE=1 SV=1
7	Q8IPC5	1.68e-142	441	639	0.249	0.372	Q8IPC5_DROME Cylindromatosis, isoform D OS=Drosophila melanogaster OX=7227 GN=CYLD PE=1 SV=1
8	Q8SYF0	7.36e-142	439	639	0.248	0.371	Q8SYF0_DROME RE64280p OS=Drosophila melanogaster OX=7227 GN=CYLD PE=2 SV=1
9	O42667	3.12e-04	47.0	670	0.026	0.037	SSM4_SCHPO Microtubule-associated protein ssm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssm4 PE=1 SV=1
10	O55156	3.58e-04	47.0	1046	0.046	0.042	CLIP2_RAT CAP-Gly domain-containing linker protein 2 OS=Rattus norvegicus OX=10116 GN=Clip2 PE=1 SV=1
11	Q9UDT6	7.25e-04	45.8	1046	0.045	0.041	CLIP2_HUMAN CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2 PE=1 SV=1
12	Q9Z0H8	0.002	44.7	1047	0.045	0.041	CLIP2_MOUSE CAP-Gly domain-containing linker protein 2 OS=Mus musculus OX=10090 GN=Clip2 PE=1 SV=2
13	Q07DR3	0.003	44.3	1218	0.026	0.021	Q07DR3_DANRE Dynactin subunit 1 OS=Danio rerio OX=7955 GN=dctn1a PE=1 SV=1
14	Q10235	0.011	40.8	234	0.023	0.094	ALP11_SCHPO Cell polarity protein alp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alp11 PE=1 SV=1
15	P13496	0.012	42.0	1265	0.026	0.020	DCTN1_DROME Dynactin subunit 1 OS=Drosophila melanogaster OX=7227 GN=DCTN1-p150 PE=1 SV=2
16	O08788	0.015	41.6	1281	0.024	0.018	DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dctn1 PE=1 SV=3
17	P28023	0.015	41.6	1280	0.024	0.018	DCTN1_RAT Dynactin subunit 1 OS=Rattus norvegicus OX=10116 GN=Dctn1 PE=1 SV=2
18	Q14203	0.015	41.6	1278	0.024	0.018	DCTN1_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=3
19	Q96DZ5	0.015	41.6	547	0.041	0.071	CLIP3_HUMAN CAP-Gly domain-containing linker protein 3 OS=Homo sapiens OX=9606 GN=CLIP3 PE=1 SV=3
20	E7EX90	0.016	41.6	1256	0.024	0.018	E7EX90_HUMAN Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01302 CAP_GLY	5.7e-34	127.2	CAP-Gly domain
2	PF06481 COX_ARM	2.5e+02	13.0	COX Aromatic Rich Motif
3	PF16607 CYLD_phos_site	1.7e-88	306.1	Phosphorylation region of CYLD, unstructured
4	PF00443 UCH	0.00055	31.1	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000392025

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315112	0.999	E3 ubiquitin-protein ligase RNF31
2	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
3	9606.ENSP00000483825	0.999	NF-kappa-B essential modulator
4	9606.ENSP00000162749	0.998	Tumor necrosis factor receptor superfamily member 1A
5	9606.ENSP00000259808	0.997	Receptor-interacting serine/threonine-protein kinase 1
6	9606.ENSP00000416799	0.997	Spermatogenesis-associated protein 2
7	9606.ENSP00000374455	0.992	Sequestosome-1
8	9606.ENSP00000245838	0.989	THO complex subunit 2
9	9606.ENSP00000390436	0.988	Zinc finger protein GLI2
10	9606.ENSP00000247668	0.986	TNF receptor-associated factor 2
11	9606.ENSP00000398698	0.986	Tumor necrosis factor
12	9606.ENSP00000441543	0.983	Polyubiquitin-C
13	9606.ENSP00000301838	0.981	FAS-associated death domain protein
14	9606.ENSP00000369213	0.981	Probable ATP-dependent RNA helicase DDX58
15	9606.ENSP00000341268	0.979	Tumor necrosis factor receptor type 1-associated DEATH domain protein
16	9606.ENSP00000358335	0.977	Mitogen-activated protein kinase kinase kinase 7
17	9606.ENSP00000381698	0.968	Sharpin
18	9606.ENSP00000430684	0.967	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000356426	0.966	TGF-beta-activated kinase 1 and MAP3K7-binding protein 2
20	9606.ENSP00000359424	0.966	Inhibitor of nuclear factor kappa-B kinase subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061578	1.000	K63-linked deubiquitinase activity
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0019899	0.986	enzyme binding
GO:0043167	0.897	ion binding
GO:0019900	0.885	kinase binding
GO:0070064	0.880	proline-rich region binding
GO:0046914	0.875	transition metal ion binding
GO:0008270	0.867	zinc ion binding
GO:0019901	0.864	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0070647	0.996	protein modification by small protein conjugation or removal
GO:0006508	0.995	proteolysis
GO:0016579	0.992	protein deubiquitination
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.987	cellular process
GO:0048518	0.979	positive regulation of biological process
GO:0080134	0.975	regulation of response to stress
GO:0048522	0.972	positive regulation of cellular process
GO:0009966	0.948	regulation of signal transduction
GO:0048519	0.945	negative regulation of biological process
GO:0002682	0.916	regulation of immune system process
GO:0032101	0.912	regulation of response to external stimulus
GO:0050896	0.911	response to stimulus
GO:0065009	0.910	regulation of molecular function
GO:0048584	0.910	positive regulation of response to stimulus
GO:0048523	0.905	negative regulation of cellular process
GO:1902531	0.905	regulation of intracellular signal transduction
GO:0009967	0.896	positive regulation of signal transduction
GO:0019222	0.891	regulation of metabolic process
GO:0060255	0.882	regulation of macromolecule metabolic process
GO:0080090	0.870	regulation of primary metabolic process
GO:0051171	0.870	regulation of nitrogen compound metabolic process
GO:0031323	0.865	regulation of cellular metabolic process
GO:0051716	0.860	cellular response to stimulus
GO:0010468	0.854	regulation of gene expression
GO:0051239	0.836	regulation of multicellular organismal process
GO:0031347	0.826	regulation of defense response
GO:0010941	0.792	regulation of cell death
GO:0050776	0.787	regulation of immune response
GO:0023052	0.782	signaling
GO:0007154	0.782	cell communication
GO:0019219	0.780	regulation of nucleobase-containing compound metabolic process
GO:0007165	0.773	signal transduction
GO:0043067	0.770	regulation of programmed cell death
GO:0002684	0.740	positive regulation of immune system process
GO:0010556	0.710	regulation of macromolecule biosynthetic process
GO:0031326	0.710	regulation of cellular biosynthetic process
GO:0006355	0.699	regulation of DNA-templated transcription
GO:0002376	0.687	immune system process
GO:0006950	0.650	response to stress
GO:0051090	0.619	regulation of DNA-binding transcription factor activity
GO:0009892	0.616	negative regulation of metabolic process
GO:0048585	0.596	negative regulation of response to stimulus
GO:0009893	0.532	positive regulation of metabolic process
GO:0010604	0.515	positive regulation of macromolecule metabolic process
GO:0001817	0.502	regulation of cytokine production
GO:0032502	0.469	developmental process
GO:0010605	0.469	negative regulation of macromolecule metabolic process
GO:0050778	0.466	positive regulation of immune response
GO:0048856	0.459	anatomical structure development
GO:0051173	0.443	positive regulation of nitrogen compound metabolic process
GO:0044237	0.442	cellular metabolic process
GO:0044419	0.432	biological process involved in interspecies interaction between organisms
GO:0009605	0.425	response to external stimulus
GO:0042981	0.418	regulation of apoptotic process
GO:0032501	0.417	multicellular organismal process
GO:1902533	0.392	positive regulation of intracellular signal transduction
GO:0051246	0.375	regulation of protein metabolic process
GO:0023057	0.347	negative regulation of signaling
GO:0051707	0.347	response to other organism
GO:0031325	0.346	positive regulation of cellular metabolic process
GO:0045088	0.344	regulation of innate immune response
GO:0042221	0.343	response to chemical
GO:0006952	0.338	defense response
GO:0009968	0.337	negative regulation of signal transduction
GO:0060759	0.323	regulation of response to cytokine stimulus
GO:0031349	0.318	positive regulation of defense response
GO:0001959	0.305	regulation of cytokine-mediated signaling pathway
GO:0043408	0.300	regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005815	0.999	microtubule organizing center
GO:0043227	0.996	membrane-bounded organelle
GO:0005886	0.994	plasma membrane
GO:0005829	0.994	cytosol
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005654	0.926	nucleoplasm
GO:0099080	0.650	supramolecular complex
GO:0005813	0.650	centrosome
GO:0032991	0.513	protein-containing complex
GO:0099512	0.485	supramolecular fiber
GO:0005819	0.481	spindle
GO:0099513	0.468	polymeric cytoskeletal fiber
GO:0005874	0.416	microtubule
GO:0019898	0.402	extrinsic component of membrane
GO:0030496	0.399	midbody
GO:0120025	0.362	plasma membrane bounded cell projection
GO:0005881	0.344	cytoplasmic microtubule
GO:0012505	0.338	endomembrane system
GO:0005929	0.336	cilium
GO:0098552	0.323	side of membrane
GO:0019897	0.307	extrinsic component of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]