StarFunc result for job id Q9NQG5

User Input

>input (326 residues)
MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFL
YLANDVIQNSKRKGPEFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGE
FIQQLKLSMEDSKSPPPKATEEKKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEEL
IKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEAAERLSKTVDEACLLLAEY
NGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSL
PDLSLLPNVTGGLAPLPSAGDLFSTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQG5	1.000	1.000	8.693E-43	326	1.000	1.000	Q9NQG5.pdb.gz	RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1
2	AFDB:Q96P16	0.435	0.454	3.959E-30	312	0.653	0.683	Q96P16.pdb.gz	RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1
3	AFDB:P34281	0.392	0.405	2.691E-16	315	0.261	0.270	P34281.pdb.gz	CIDS1_CAEEL CID domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=cids-1 PE=4 SV=2
4	AFDB:Q5VT52	0.364	0.087	4.317E-12	1461	0.261	0.058	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
5	AFDB:A0A0P0WFI1	0.385	0.245	5.520E-12	528	0.279	0.172	A0A0P0WFI1.pdb.gz	A0A0P0WFI1_ORYSJ Os04g0636700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0636700 PE=1 SV=1
6	AFDB:O74814	0.393	0.333	1.561E-10	387	0.187	0.158	O74814.pdb.gz	YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.03 PE=1 SV=1
7	AFDB:Q05543	0.394	0.316	1.070E-8	409	0.196	0.156	Q05543.pdb.gz	RT103_YEAST Regulator of Ty1 transposition protein 103 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT103 PE=1 SV=1
8	AFDB:A5Z2V1	0.374	0.188	2.486E-7	664	0.156	0.077	A5Z2V1.pdb.gz	A5Z2V1_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
9	AFDB:O95104	0.357	0.109	1.399E-5	1147	0.132	0.037	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
10	AFDB:Q9UPN6	0.367	0.098	1.974E-5	1271	0.141	0.036	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
11	PDB:7oo3c	0.287	0.589	1.202E-1	141	0.058	0.135	7oo3c.pdb.gz	Structural basis of human transcription-DNA repair coupling.
12	PDB:4ct7B	0.174	0.201	1.536E-1	269	0.092	0.112	4ct7B.pdb.gz	Structural and Biochemical Insights to the Role of the Ccr4-not Complex and Ddx6 ATPase in Microrna Repression.
13	PDB:6tedQ	0.171	0.081	1.614E-1	890	0.144	0.053	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
14	PDB:4jlqA	0.182	0.082	3.373E-1	840	0.071	0.027	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	PDB:1qgkA	0.191	0.088	4.106E-1	876	0.126	0.047	1qgkA.pdb.gz
16	PDB:5bw9g	0.254	0.437	7.406E-1	141	0.043	0.099	5bw9g.pdb.gz
17	PDB:5lhdC	0.132	0.060	9.015E-1	905	0.074	0.027	5lhdC.pdb.gz	Allosteric inhibition of aminopeptidase N functions related to tumor growth and virus infection.
18	PDB:7dvqK	0.135	0.192	9.015E-1	188	0.046	0.080	7dvqK.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:6xu2A	0.164	0.065	9.469E-1	1091	0.126	0.038	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
20	PDB:7dkhI	0.110	0.053	9.469E-1	914	0.110	0.039	7dkhI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQG5	0.0	661	326	1.000	1.000	RPR1B_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1B OS=Homo sapiens OX=9606 GN=RPRD1B PE=1 SV=1
2	Q96P16	1.12e-148	422	312	0.653	0.683	RPR1A_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 1A OS=Homo sapiens OX=9606 GN=RPRD1A PE=1 SV=1
3	A0A0P0WFI1	3.11e-31	124	528	0.178	0.110	A0A0P0WFI1_ORYSJ Os04g0636700 protein OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0636700 PE=1 SV=1
4	P34281	4.93e-29	115	315	0.288	0.298	CIDS1_CAEEL CID domain-containing protein 1 OS=Caenorhabditis elegans OX=6239 GN=cids-1 PE=4 SV=2
5	Q5VT52	7.00e-20	92.8	1461	0.248	0.055	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
6	Q05543	1.56e-11	67.0	409	0.123	0.098	RT103_YEAST Regulator of Ty1 transposition protein 103 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RTT103 PE=1 SV=1
7	O74814	2.61e-09	60.1	387	0.095	0.080	YJ03_SCHPO UPF0400 protein C337.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC337.03 PE=1 SV=1
8	A5Z2V0	4.31e-07	53.9	662	0.092	0.045	A5Z2V0_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
9	Q9XVN9	4.50e-07	53.5	658	0.092	0.046	Q9XVN9_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=2
10	Q8I4J5	4.70e-07	53.5	656	0.092	0.046	Q8I4J5_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=2
11	A5Z2V1	1.78e-06	52.0	664	0.083	0.041	A5Z2V1_CAEEL CID domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=cids-2 PE=1 SV=1
12	O94913	7.96e-04	43.9	1555	0.089	0.019	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
13	A0A0A0MT33	0.002	42.4	1349	0.098	0.024	A0A0A0MT33_HUMAN SR-related CTD associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
14	Q9UPN6	0.002	42.4	1271	0.098	0.025	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
15	Q5U393	0.003	42.0	1457	0.083	0.019	Q5U393_DANRE Cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) OS=Danio rerio OX=7955 GN=zgc:175013 PE=1 SV=1
16	Q63623	0.020	39.3	1268	0.095	0.024	SCAF8_RAT SR-related and CTD-associated factor 8 OS=Rattus norvegicus OX=10116 GN=Scaf8 PE=1 SV=1
17	A8DYK5	0.033	38.5	1306	0.083	0.021	A8DYK5_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Isha PE=1 SV=1
18	O95104	0.044	38.1	1147	0.067	0.019	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
19	Q63627	0.044	38.1	1200	0.067	0.018	SCAF4_RAT SR-related and CTD-associated factor 4 OS=Rattus norvegicus OX=10116 GN=Scaf4 PE=1 SV=2
20	Q0WPF2	0.050	37.7	808	0.089	0.036	PCFS4_ARATH Polyadenylation and cleavage factor homolog 4 OS=Arabidopsis thaliana OX=3702 GN=PCFS4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04818 CID	1.5e-33	127.0	CID domain
2	PF16566 CREPT	9.5e-62	218.9	Cell-cycle alteration and expression-elevated protein in tumour
3	PF12243 CTK3	12	17.3	CTD kinase subunit gamma CTK3
4	PF02388 FemAB	54	14.1	FemAB family
5	PF09058 L27_1	1.7e+02	13.4	L27_1
6	PF16021 PDCD7	6.6e+02	10.8	Programmed cell death protein 7
7	PF05797 Rep_4	4.1e+02	11.5	Yeast trans-acting factor (REP1/REP2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010638348.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010643219.1	0.958	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
2	885580.XP_010613165.1	0.935	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
3	885580.XP_010637190.1	0.928	DNA-directed RNA polymerase II subunit RPB3
4	885580.XP_010614700.1	0.916	Regulation of nuclear pre-mRNA domain-containing protein 2
5	885580.XP_010607824.1	0.914	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
6	885580.XP_010630186.1	0.902	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
7	885580.XP_010631277.1	0.902	DNA-directed RNA polymerase II subunit RPB7
8	885580.XP_010635941.1	0.899	DNA-directed RNA polymerase II subunit RPB4
9	885580.XP_010638676.1	0.891	DNA-directed RNA polymerases I, II, and III subunit RPABC5
10	885580.XP_010636343.1	0.883	Regulation of nuclear pre-mRNA domain-containing protein 1A
11	885580.XP_010633257.1	0.879	DNA-directed RNA polymerases I, II, and III subunit RPABC1 isoform X1
12	885580.XP_010629183.1	0.835	Pre-mRNA cleavage complex 2 protein Pcf11
13	885580.XP_010626017.1	0.830	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
14	885580.XP_010617254.1	0.825	DNA-directed RNA polymerase II subunit RPB11-a
15	885580.XP_010616706.1	0.765	ATP-dependent DNA helicase Q5 isoform X1
16	885580.XP_010622850.1	0.756	UBX domain-containing protein 7
17	885580.XP_010612810.1	0.749	Transcription elongation factor SPT5 isoform X1
18	885580.XP_010642993.1	0.748	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 9 samples with support for all annotated introns
19	885580.XP_010611442.1	0.746	DNA-directed RNA polymerases I, II, and III subunit RPABC2
20	885580.XP_010613301.1	0.723	Protein asunder homolog isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0000993	0.999	RNA polymerase II complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050789	0.996	regulation of biological process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0050794	0.992	regulation of cellular process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0006357	0.978	regulation of transcription by RNA polymerase II
GO:0045935	0.974	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.971	positive regulation of macromolecule metabolic process
GO:0006470	0.950	protein dephosphorylation
GO:0051254	0.931	positive regulation of RNA metabolic process
GO:0031328	0.924	positive regulation of cellular biosynthetic process
GO:0010557	0.921	positive regulation of macromolecule biosynthetic process
GO:0045893	0.856	positive regulation of DNA-templated transcription
GO:0051726	0.793	regulation of cell cycle
GO:0045944	0.678	positive regulation of transcription by RNA polymerase II
GO:0042127	0.673	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016591	1.000	RNA polymerase II, holoenzyme
GO:0005737	0.621	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]