StarFunc result for job id Q9NQG6

User Input

>input (463 residues)
MAGAGERKGKKDDNGIGTAIDFVLSNARLVLGVGGAAMLGIATLAVKRMYDRAISAPTSP
TRLSHSGKRSWEEPNWMGSPRLLNRDMKTGLSRSLQTLPTDSSTFDTDTFCPPRPKPVAR
KGQVDLKKSRLRMSLQEKLLTYYRNRAAIPAGEQARAKQAAVDICAELRSFLRAKLPDMP
LRDMYLSGSLYDDLQVVTADHIQLIVPLVLEQNLWSCIPGEDTIMNVPGFFLVRRENPEY
FPRGSSYWDRCVVGGYLSPKTVADTFEKVVAGSINWPAIGSLLDYVIRPAPPPEALTLEV
QYERDKHLFIDFLPSVTLGDTVLVAKPHRLAQYDNLWRLSLRPAETARLRALDQADSGCR
SLCLKILKAICKSTPALGHLTASQLTNVILHLAQEEADWSPDMLADRFLQALRGLISYLE
AGVLPSALNPKVNLFAELTPEEIDELGYTLYCSLSEPEVLLQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5XIS8	0.901	0.901	1.815E-71	463	0.981	0.981	Q5XIS8.pdb.gz	MID51_RAT Mitochondrial dynamics protein MID51 OS=Rattus norvegicus OX=10116 GN=Mief1 PE=1 SV=1
2	AFDB:Q96C03	0.736	0.749	3.520E-41	454	0.436	0.445	Q96C03.pdb.gz	MID49_HUMAN Mitochondrial dynamics protein MID49 OS=Homo sapiens OX=9606 GN=MIEF2 PE=1 SV=1
3	AFDB:Q5NCS9	0.677	0.690	8.026E-38	454	0.413	0.421	Q5NCS9.pdb.gz	MID49_MOUSE Mitochondrial dynamics protein MID49 OS=Mus musculus OX=10090 GN=Mief2 PE=1 SV=1
4	AFDB:A7SFB5	0.591	0.645	1.300E-20	422	0.201	0.220	A7SFB5.pdb.gz	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
5	AFDB:F1QCP4	0.590	0.469	8.955E-16	592	0.177	0.139	F1QCP4.pdb.gz	F1QCP4_DANRE Cyclic GMP-AMP synthase OS=Danio rerio OX=7955 GN=mb21d1 PE=3 SV=2
6	AFDB:Q6GPH6	0.537	0.459	2.021E-15	555	0.177	0.148	Q6GPH6.pdb.gz	IPIL1_HUMAN Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1 OS=Homo sapiens OX=9606 GN=ITPRIPL1 PE=1 SV=1
7	AFDB:Q8C6L5	0.590	0.541	7.584E-15	507	0.156	0.142	Q8C6L5.pdb.gz	CGAS_MOUSE Cyclic GMP-AMP synthase OS=Mus musculus OX=10090 GN=Cgas PE=1 SV=1
8	PDB:7lt2A	0.542	0.637	4.620E-13	387	0.140	0.168	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
9	PDB:5eomC	0.462	0.585	1.345E-12	353	0.143	0.187	5eomC.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
10	PDB:7buqA	0.496	0.610	3.913E-12	362	0.130	0.166	7buqA.pdb.gz	Mn2+Directly Activates cGAS and Structural Analysis Suggests Mn2+Induces a Noncanonical Catalytic Synthesis of 2'3'-cGAMP.
11	PDB:5eogF	0.455	0.604	1.068E-10	330	0.136	0.191	5eogF.pdb.gz
12	AFDB:Q8IYB1	0.519	0.492	1.240E-9	491	0.140	0.132	Q8IYB1.pdb.gz	M21D2_HUMAN Nucleotidyltransferase MB21D2 OS=Homo sapiens OX=9606 GN=MB21D2 PE=1 SV=3
13	PDB:7lt1A	0.513	0.581	2.041E-9	403	0.132	0.151	7lt1A.pdb.gz
14	PDB:5eomJ	0.393	0.601	7.844E-7	286	0.127	0.206	5eomJ.pdb.gz	Structural and biochemical characterization of the cell fate determining nucleotidyltransferase fold protein MAB21L1.
15	AFDB:F4ZW62	0.416	0.484	1.789E-6	390	0.106	0.126	F4ZW62.pdb.gz	F4ZW62_HUMAN NF45 OS=Homo sapiens OX=9606 PE=1 SV=1
16	PDB:4atbA	0.409	0.542	6.643E-6	334	0.102	0.141	4atbA.pdb.gz	NF45 Dimerizes with NF90, Zfr and Spnr Via a Conserved Domain that Has a Nucleotidyltransferase Fold.
17	PDB:6e0nA	0.397	0.619	2.252E-5	271	0.076	0.129	6e0nA.pdb.gz	Bacterial cGAS-like enzymes synthesize diverse nucleotide signals.
18	PDB:4xj6A	0.323	0.389	5.082E-5	370	0.093	0.116	4xj6A.pdb.gz	Structural Basis for the Catalytic Mechanism of DncV, Bacterial Homolog of Cyclic GMP-AMP Synthase
19	PDB:4rwnA	0.388	0.498	2.222E-4	349	0.091	0.120	4rwnA.pdb.gz	The Activation Mechanism of 2'-5'-Oligoadenylate Synthetase Gives New Insights Into OAS/cGAS Triggers of Innate Immunity.
20	AFDB:P39113	0.081	0.035	3.196	1433	0.121	0.039	P39113.pdb.gz	CAT8_YEAST Regulatory protein CAT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CAT8 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5XIS8	0.0	934	463	0.981	0.981	MID51_RAT Mitochondrial dynamics protein MID51 OS=Rattus norvegicus OX=10116 GN=Mief1 PE=1 SV=1
2	Q8BGV8	0.0	933	463	0.978	0.978	MID51_MOUSE Mitochondrial dynamics protein MID51 OS=Mus musculus OX=10090 GN=Mief1 PE=1 SV=1
3	Q9NQG6	0.0	947	463	1.000	1.000	MID51_HUMAN Mitochondrial dynamics protein MIEF1 OS=Homo sapiens OX=9606 GN=MIEF1 PE=1 SV=1
4	Q96C03	8.59e-117	352	454	0.462	0.471	MID49_HUMAN Mitochondrial dynamics protein MID49 OS=Homo sapiens OX=9606 GN=MIEF2 PE=1 SV=1
5	Q5NCS9	8.04e-103	316	454	0.408	0.416	MID49_MOUSE Mitochondrial dynamics protein MID49 OS=Mus musculus OX=10090 GN=Mief2 PE=1 SV=1
6	A7SFB5	2.33e-11	67.8	422	0.143	0.156	CGAS_NEMVE Cyclic GMP-AMP synthase OS=Nematostella vectensis OX=45351 GN=v1g211400 PE=1 SV=1
7	Q8N8X9	1.23e-04	46.6	362	0.076	0.097	MB213_HUMAN Protein mab-21-like 3 OS=Homo sapiens OX=9606 GN=MAB21L3 PE=1 SV=2
8	Q9Y106	0.055	38.1	368	0.065	0.082	MB21L_DROME Protein mab-21-like OS=Drosophila melanogaster OX=7227 GN=CG4766 PE=1 SV=1
9	Q8UUZ1	0.11	37.0	359	0.058	0.075	MB212_DANRE Protein mab-21-like 2 OS=Danio rerio OX=7955 GN=mab21l2 PE=1 SV=1
10	Q9Y586	0.26	35.8	359	0.056	0.072	MB212_HUMAN Protein mab-21-like 2 OS=Homo sapiens OX=9606 GN=MAB21L2 PE=1 SV=1
11	Q8BPP1	0.41	35.4	359	0.056	0.072	MB212_MOUSE Protein mab-21-like 2 OS=Mus musculus OX=10090 GN=Mab21l2 PE=2 SV=1
12	O70299	0.73	34.7	359	0.056	0.072	MB211_MOUSE Putative nucleotidyltransferase MAB21L1 OS=Mus musculus OX=10090 GN=Mab21l1 PE=2 SV=1
13	Q13394	0.73	34.7	359	0.056	0.072	MB211_HUMAN Putative nucleotidyltransferase MAB21L1 OS=Homo sapiens OX=9606 GN=MAB21L1 PE=1 SV=1
14	Q8C6L5	1.3	33.9	507	0.048	0.043	CGAS_MOUSE Cyclic GMP-AMP synthase OS=Mus musculus OX=10090 GN=Cgas PE=1 SV=1
15	Q01908	2.3	33.1	373	0.043	0.054	ATPG1_ARATH ATP synthase gamma chain 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ATPC1 PE=1 SV=1
16	P49816	3.1	33.1	1809	0.058	0.015	TSC2_RAT Tuberin OS=Rattus norvegicus OX=10116 GN=Tsc2 PE=1 SV=1
17	B4QGZ2	3.6	32.3	393	0.084	0.099	CGLR1_DROSI Cyclic GMP-AMP synthase-like receptor 1 OS=Drosophila simulans OX=7240 GN=GD11141 PE=3 SV=2
18	Q9QXS1	4.8	32.3	4691	0.060	0.006	PLEC_MOUSE Plectin OS=Mus musculus OX=10090 GN=Plec PE=1 SV=3
19	P30427	5.1	32.3	4687	0.060	0.006	PLEC_RAT Plectin OS=Rattus norvegicus OX=10116 GN=Plec PE=1 SV=2
20	Q6R5P0	5.7	32.0	926	0.048	0.024	TLR11_MOUSE Toll-like receptor 11 OS=Mus musculus OX=10090 GN=Tlr11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03281 Mab-21	2.3e+02	13.3	Mab-21 protein nucleotidyltransferase domain
2	PF20266 Mab-21_C	2.7e-07	42.0	Mab-21 protein HhH/H2TH-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327124

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000449089	0.997	Dynamin-1-like protein
2	9606.ENSP00000223136	0.986	Mitochondrial fission 1 protein
3	9606.ENSP00000302037	0.963	Mitochondrial fission factor
4	9606.ENSP00000420617	0.874	Mitofusin-1
5	9606.ENSP00000280557	0.828	Density-regulated protein
6	9606.ENSP00000235329	0.762	Mitofusin-2
7	9606.ENSP00000355566	0.740	Mitochondrial import receptor subunit TOM20 homolog
8	9606.ENSP00000376246	0.717	Protein MB21D2
9	9606.ENSP00000362014	0.689	Dynamin-1
10	9606.ENSP00000318480	0.677	ATP-dependent zinc metalloprotease YME1L1
11	9606.ENSP00000481912	0.676	Carbohydrate sulfotransferase 12
12	9606.ENSP00000220822	0.675	Ganglioside-induced differentiation-associated protein 1
13	9606.ENSP00000400057	0.674	Isoaspartyl peptidase/L-asparaginase
14	9606.ENSP00000354681	0.650	Dynamin-like 120 kDa protein, mitochondrial
15	9606.ENSP00000370849	0.637	Inositol 1,4,5-trisphosphate receptor-interacting protein-like 2
16	9606.ENSP00000324701	0.633	Protein mab-21-like 2
17	9606.ENSP00000483059	0.633	Nuclear receptor subfamily 2 group C member 2
18	9606.ENSP00000360270	0.604	Metalloendopeptidase OMA1, mitochondrial
19	9606.ENSP00000373905	0.600	Dynamin-2
20	9606.ENSP00000414721	0.599	WW domain binding protein 1 like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.999	identical protein binding
GO:0003824	0.792	catalytic activity
GO:0097159	0.706	organic cyclic compound binding
GO:1901363	0.673	heterocyclic compound binding
GO:0016740	0.653	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0022603	0.996	regulation of anatomical structure morphogenesis
GO:0010821	0.996	regulation of mitochondrion organization
GO:0009987	0.993	cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.978	positive regulation of cellular process
GO:0090140	0.976	regulation of mitochondrial fission
GO:0010822	0.973	positive regulation of mitochondrion organization
GO:0071840	0.945	cellular component organization or biogenesis
GO:0016043	0.931	cellular component organization
GO:0032880	0.925	regulation of protein localization
GO:1905475	0.885	regulation of protein localization to membrane
GO:0050896	0.798	response to stimulus
GO:0006996	0.786	organelle organization
GO:0007005	0.779	mitochondrion organization
GO:0051223	0.605	regulation of protein transport
GO:0051094	0.599	positive regulation of developmental process
GO:0032386	0.572	regulation of intracellular transport
GO:0051716	0.555	cellular response to stimulus
GO:1903829	0.467	positive regulation of protein localization
GO:0033157	0.408	regulation of intracellular protein transport
GO:0051222	0.408	positive regulation of protein transport
GO:1903533	0.357	regulation of protein targeting
GO:1905477	0.339	positive regulation of protein localization to membrane
GO:0032388	0.333	positive regulation of intracellular transport
GO:0090316	0.317	positive regulation of intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0016020	0.996	membrane
GO:0031975	0.984	envelope
GO:0031090	0.980	organelle membrane
GO:0005740	0.961	mitochondrial envelope
GO:0031966	0.951	mitochondrial membrane
GO:0005741	0.900	mitochondrial outer membrane
GO:0005634	0.381	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.653	Transferases.

[back to server]