StarFunc result for job id Q9NQL2

User Input

>input (400 residues)
MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTE
VKPRILLMGLRRSGKSSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPG
QIDFFDPTFDYEMIFRGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHK
VDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLIPQ
LPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIY
GLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNFHCF
RKAIHEVFEVRMKVVKSRKVQNRLQKKKRATPNGTPRVLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQL2	1.000	1.000	2.118E-75	400	1.000	1.000	Q9NQL2.pdb.gz	RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens OX=9606 GN=RRAGD PE=1 SV=1
2	AFDB:Q9HB90	0.797	0.799	7.571E-56	399	0.748	0.749	Q9HB90.pdb.gz	RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1
3	AFDB:Q7K519	0.807	0.838	5.536E-55	385	0.635	0.660	Q7K519.pdb.gz	Q7K519_DROME GH16429p OS=Drosophila melanogaster OX=7227 GN=RagC-D PE=1 SV=1
4	AFDB:Q54PK6	0.810	0.899	8.473E-52	360	0.585	0.650	Q54PK6.pdb.gz	Q54PK6_DICDI Ras-related GTP-binding protein OS=Dictyostelium discoideum OX=44689 GN=ragC PE=3 SV=1
5	PDB:6ulgG	0.760	0.977	2.263E-51	310	0.715	0.923	6ulgG.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
6	AFDB:O74544	0.747	0.949	1.493E-45	314	0.482	0.615	O74544.pdb.gz	RAGCD_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr2 PE=3 SV=1
7	PDB:6s6dC	0.661	0.918	1.175E-44	284	0.650	0.915	6s6dC.pdb.gz	Architecture of human Rag GTPase heterodimers and their complex with mTORC1.
8	AFDB:G5EGB3	0.775	0.915	1.450E-42	338	0.405	0.479	G5EGB3.pdb.gz	G5EGB3_CAEEL Ras-related GTP-binding protein C OS=Caenorhabditis elegans OX=6239 GN=ragc-1 PE=1 SV=1
9	AFDB:P53290	0.758	0.886	2.349E-39	341	0.375	0.440	P53290.pdb.gz	RAGCD_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTR2 PE=1 SV=1
10	AFDB:Q38A82	0.704	0.826	8.187E-31	339	0.330	0.389	Q38A82.pdb.gz	Q38A82_TRYB2 Small GTPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1520 PE=3 SV=1
11	PDB:4arzB	0.566	0.721	2.904E-28	304	0.370	0.487	4arzB.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
12	AFDB:O74824	0.660	0.841	8.401E-22	308	0.163	0.211	O74824.pdb.gz	RAGAB_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr1 PE=3 SV=1
13	AFDB:Q22743	0.647	0.815	4.127E-21	312	0.155	0.199	Q22743.pdb.gz	Q22743_CAEEL GTP-binding protein OS=Caenorhabditis elegans OX=6239 GN=raga-1 PE=1 SV=1
14	PDB:4arzA	0.604	0.808	4.437E-19	291	0.170	0.234	4arzA.pdb.gz	Crystal Structure of the Gtr1Pgtp-Gtr2Pgdp Complex Reveals Large Structural Rearrangements Triggered by GTP-to-Gdp Conversion
15	PDB:6cesA	0.630	0.822	1.639E-16	300	0.150	0.200	6cesA.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
16	PDB:6jwpG	0.322	0.640	2.438E-12	197	0.152	0.310	6jwpG.pdb.gz	Structural insights into the EGO-TC-mediated membrane tethering of the TORC1-regulatory Rag GTPases.
17	PDB:6nzdF	0.419	0.676	2.114E-11	227	0.125	0.220	6nzdF.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
18	PDB:6bbpA	0.321	0.252	1.068E-7	520	0.085	0.065	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
19	PDB:1uptG	0.326	0.700	1.130E-7	170	0.095	0.224	1uptG.pdb.gz	Structural Basis for Arl1-Dependent Targeting of Homodimeric Grip Domains to the Golgi Apparatus
20	PDB:3lvqE	0.330	0.316	1.340E-7	420	0.095	0.090	3lvqE.pdb.gz	The structure of an Arf-ArfGAP complex reveals a Ca2+ regulatory mechanism

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q99K70	0.0	614	398	0.735	0.739	RRAGC_MOUSE Ras-related GTP-binding protein C OS=Mus musculus OX=10090 GN=Rragc PE=1 SV=1
2	Q9HB90	0.0	616	399	0.738	0.739	RRAGC_HUMAN Ras-related GTP-binding protein C OS=Homo sapiens OX=9606 GN=RRAGC PE=1 SV=1
3	Q9NQL2	0.0	823	400	1.000	1.000	RRAGD_HUMAN Ras-related GTP-binding protein D OS=Homo sapiens OX=9606 GN=RRAGD PE=1 SV=1
4	Q7K519	3.46e-179	505	385	0.608	0.631	Q7K519_DROME GH16429p OS=Drosophila melanogaster OX=7227 GN=RagC-D PE=1 SV=1
5	Q54PK6	2.06e-169	479	360	0.588	0.653	Q54PK6_DICDI Ras-related GTP-binding protein OS=Dictyostelium discoideum OX=44689 GN=ragC PE=3 SV=1
6	O74544	8.31e-144	413	314	0.492	0.627	RAGCD_SCHPO GTP-binding protein gtr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr2 PE=3 SV=1
7	G5EGB3	8.75e-110	327	338	0.412	0.488	G5EGB3_CAEEL Ras-related GTP-binding protein C OS=Caenorhabditis elegans OX=6239 GN=ragc-1 PE=1 SV=1
8	P53290	3.34e-99	300	341	0.375	0.440	RAGCD_YEAST GTP-binding protein GTR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTR2 PE=1 SV=1
9	Q38A82	3.63e-68	221	339	0.333	0.392	Q38A82_TRYB2 Small GTPase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1520 PE=3 SV=1
10	Q7ZUI2	3.67e-14	75.1	315	0.150	0.190	Q7ZUI2_DANRE Ras-related GTP-binding protein OS=Danio rerio OX=7955 GN=zgc:56499 PE=1 SV=1
11	Q5VZM2	4.68e-14	75.1	374	0.193	0.206	RRAGB_HUMAN Ras-related GTP-binding protein B OS=Homo sapiens OX=9606 GN=RRAGB PE=1 SV=1
12	Q63486	3.53e-13	72.0	313	0.147	0.188	RRAGA_RAT Ras-related GTP-binding protein A OS=Rattus norvegicus OX=10116 GN=Rraga PE=1 SV=1
13	Q7L523	3.53e-13	72.0	313	0.147	0.188	RRAGA_HUMAN Ras-related GTP-binding protein A OS=Homo sapiens OX=9606 GN=RRAGA PE=1 SV=1
14	Q80X95	3.53e-13	72.0	313	0.147	0.188	RRAGA_MOUSE Ras-related GTP-binding protein A OS=Mus musculus OX=10090 GN=Rraga PE=1 SV=1
15	Q63487	6.59e-13	71.6	374	0.182	0.195	RRAGB_RAT Ras-related GTP-binding protein B OS=Rattus norvegicus OX=10116 GN=RragB PE=1 SV=1
16	O74824	2.41e-12	69.3	308	0.155	0.201	RAGAB_SCHPO GTP-binding protein gtr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gtr1 PE=3 SV=1
17	Q22743	1.73e-11	67.0	312	0.145	0.186	Q22743_CAEEL GTP-binding protein OS=Caenorhabditis elegans OX=6239 GN=raga-1 PE=1 SV=1
18	Q9VHJ4	5.14e-11	65.5	311	0.140	0.180	Q9VHJ4_DROME GH04846p OS=Drosophila melanogaster OX=7227 GN=RagA-B PE=1 SV=1
19	Q00582	3.21e-09	60.1	310	0.125	0.161	RAGAB_YEAST GTP-binding protein GTR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GTR1 PE=1 SV=1
20	A0A1D8PI64	1.38e-07	55.5	352	0.122	0.139	A0A1D8PI64_CANAL GTP-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=GTR1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13173 AAA_14	4e+02	12.4	AAA domain
2	PF13191 AAA_16	1.9e+02	13.8	AAA ATPase domain
3	PF00025 Arf	0.00087	30.3	ADP-ribosylation factor family
4	PF04670 Gtr1_RagA	4.2e-68	240.8	Gtr1/RagA G protein conserved region
5	PF01926 MMR_HSR1	29	16.2	50S ribosome-binding GTPase
6	PF00071 Ras	7.9	17.5	Ras family
7	PF08477 Roc	0.14	23.8	Ras of Complex, Roc, domain of DAPkinase
8	PF09439 SRPRB	0.039	24.9	Signal recognition particle receptor beta subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000015968

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000022844	0.998	Ras-related GTP binding A
2	61853.ENSNLEP00000016595	0.996	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 3
3	61853.ENSNLEP00000011677	0.989	Serine/threonine-protein kinase mTOR
4	61853.ENSNLEP00000019829	0.988	Ras-related GTP binding B
5	61853.ENSNLEP00000004377	0.985	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5
6	61853.ENSNLEP00000019227	0.985	Regulatory associated protein of MTOR, complex 1
7	61853.ENSNLEP00000001961	0.972	Solute carrier family 38, member 9
8	61853.ENSNLEP00000015258	0.967	Folliculin interacting protein 1
9	61853.ENSNLEP00000014953	0.966	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 2
10	61853.ENSNLEP00000007821	0.964	Folliculin interacting protein 2
11	61853.ENSNLEP00000011254	0.944	MTOR associated protein, LST8 homolog (S. cerevisiae)
12	61853.ENSNLEP00000014355	0.925	annotation not available
13	61853.ENSNLEP00000006561	0.918	AKT1 substrate 1 (proline-rich)
14	61853.ENSNLEP00000008544	0.907	NPR2 like, GATOR1 complex subunit
15	61853.ENSNLEP00000005768	0.884	DEP domain containing 5
16	61853.ENSNLEP00000006084	0.884	DEP domain containing MTOR-interacting protein
17	61853.ENSNLEP00000016294	0.880	Uncharacterized protein
18	61853.ENSNLEP00000009719	0.870	NPR3 like, GATOR1 complex subunit
19	61853.ENSNLEP00000015527	0.854	Interleukin 4
20	61853.ENSNLEP00000020929	0.845	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005525	0.999	GTP binding
GO:0003924	0.998	GTPase activity
GO:0019003	0.985	GDP binding
GO:0046982	0.932	protein heterodimerization activity
GO:0019899	0.924	enzyme binding
GO:0051020	0.832	GTPase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0051716	0.996	cellular response to stimulus
GO:0009991	0.996	response to extracellular stimulus
GO:0071496	0.995	cellular response to external stimulus
GO:0009267	0.989	cellular response to starvation
GO:0043200	0.988	response to amino acid
GO:0048583	0.985	regulation of response to stimulus
GO:0023051	0.985	regulation of signaling
GO:0010646	0.985	regulation of cell communication
GO:1990928	0.983	response to amino acid starvation
GO:1902531	0.978	regulation of intracellular signal transduction
GO:0034198	0.960	cellular response to amino acid starvation
GO:1903432	0.955	regulation of TORC1 signaling
GO:0048518	0.941	positive regulation of biological process
GO:0048522	0.931	positive regulation of cellular process
GO:1901699	0.931	cellular response to nitrogen compound
GO:0071417	0.911	cellular response to organonitrogen compound
GO:0071229	0.908	cellular response to acid chemical
GO:1901701	0.902	cellular response to oxygen-containing compound
GO:0032008	0.890	positive regulation of TOR signaling
GO:0071230	0.853	cellular response to amino acid stimulus
GO:1904263	0.748	positive regulation of TORC1 signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0000323	0.995	lytic vacuole
GO:0005764	0.978	lysosome
GO:0043232	0.964	intracellular non-membrane-bounded organelle
GO:0016020	0.877	membrane
GO:0032991	0.614	protein-containing complex
GO:0005856	0.417	cytoskeleton
GO:0015630	0.386	microtubule cytoskeleton
GO:0031090	0.322	organelle membrane
GO:0005815	0.302	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.998	GTP + H2O = GDP + H(+) + phosphate

[back to server]