StarFunc result for job id Q9NQP4

User Input

>input (134 residues)
MAATMKKAAAEDVNVTFEDQQKINKFARNTSRITELKEEIEVKKKQLQNLEDACDDIMLA
DDDCLMIPYQIGDVFISHSQEETQEMLEEAKKNLQEEIDALESRVESIQRVLADLKVQLY
AKFGSNINLEADES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2TBR6	0.915	0.915	1.549E-17	134	0.993	0.993	Q2TBR6.pdb.gz	PFD4_BOVIN Prefoldin subunit 4 OS=Bos taurus OX=9913 GN=PFDN4 PE=2 SV=1
2	AFDB:Q9M4B5	0.864	0.895	1.202E-9	129	0.388	0.403	Q9M4B5.pdb.gz	PFD4_ARATH Prefoldin subunit 4 OS=Arabidopsis thaliana OX=3702 GN=PFD4 PE=1 SV=3
3	AFDB:P53900	0.867	0.900	1.708E-8	129	0.343	0.357	P53900.pdb.gz	PFD4_YEAST Prefoldin subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIM3 PE=1 SV=1
4	AFDB:Q387H0	0.816	0.879	1.512E-6	124	0.306	0.331	Q387H0.pdb.gz	Q387H0_TRYB2 Prefoldin subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0335 PE=3 SV=1
5	AFDB:Q9UTD4	0.841	0.913	3.452E-6	123	0.276	0.301	Q9UTD4.pdb.gz	PFD4_SCHPO Probable prefoldin subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.05 PE=3 SV=1
6	PDB:2zdiB	0.716	0.894	5.756E-4	106	0.127	0.160	2zdiB.pdb.gz
7	AFDB:O58268	0.743	0.844	9.367E-4	117	0.142	0.162	O58268.pdb.gz	PFDB_PYRHO Prefoldin subunit beta OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=pfdB PE=1 SV=1
8	AFDB:O14450	0.706	0.820	1.118E-3	114	0.149	0.175	O14450.pdb.gz	PFD6_SCHPO Probable prefoldin subunit 6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC3A11.13 PE=3 SV=1
9	AFDB:Q17827	0.668	0.755	3.233E-3	117	0.134	0.154	Q17827.pdb.gz	PFD1_CAEEL Probable prefoldin subunit 1 OS=Caenorhabditis elegans OX=6239 GN=pfd-1 PE=2 SV=1
10	AFDB:A1A4P5	0.695	0.611	3.858E-3	154	0.164	0.143	A1A4P5.pdb.gz	PFD2_BOVIN Prefoldin subunit 2 OS=Bos taurus OX=9913 GN=PFDN2 PE=2 SV=1
11	AFDB:Q9LJ98	0.694	0.633	6.959E-3	148	0.164	0.149	Q9LJ98.pdb.gz	PFD2_ARATH Prefoldin subunit 2 OS=Arabidopsis thaliana OX=3702 GN=PFD2 PE=1 SV=1
12	PDB:2zdiC	0.581	0.532	3.170E-1	148	0.104	0.095	2zdiC.pdb.gz
13	PDB:5ew5A	0.321	0.124	4.014E-1	490	0.112	0.031	5ew5A.pdb.gz
14	PDB:7n6g3I	0.312	0.144	4.258E-1	401	0.082	0.027	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
15	PDB:1serB	0.277	0.118	6.434E-1	421	0.149	0.048	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
16	PDB:2b5uA	0.322	0.123	7.239E-1	470	0.119	0.034	2b5uA.pdb.gz
17	PDB:6tuyA	0.585	0.122	9.166E-1	667	0.112	0.022	6tuyA.pdb.gz	Novel non-covalent LSD1 inhibitors endowed with anticancer effects in leukemia and solid tumor cellular models.
18	PDB:7sqcO1	0.312	0.097	9.166E-1	673	0.075	0.015	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
19	PDB:6r1mB	0.297	0.127	9.723E-1	428	0.149	0.047	6r1mB.pdb.gz	Structure-Guided Enhancement of Selectivity of Chemical Probe Inhibitors Targeting Bacterial Seryl-tRNA Synthetase.
20	PDB:7nsuD	0.456	0.169	1.160	420	0.119	0.038	7nsuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQP4	8.13e-94	268	134	1.000	1.000	PFD4_HUMAN Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1
2	Q2TBR6	3.28e-93	266	134	0.993	0.993	PFD4_BOVIN Prefoldin subunit 4 OS=Bos taurus OX=9913 GN=PFDN4 PE=2 SV=1
3	Q9M4B5	1.77e-21	85.1	129	0.366	0.380	PFD4_ARATH Prefoldin subunit 4 OS=Arabidopsis thaliana OX=3702 GN=PFD4 PE=1 SV=3
4	P53900	1.82e-17	74.7	129	0.343	0.357	PFD4_YEAST Prefoldin subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIM3 PE=1 SV=1
5	Q387H0	3.98e-14	66.2	124	0.313	0.339	Q387H0_TRYB2 Prefoldin subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0335 PE=3 SV=1
6	Q9UTD4	7.18e-08	49.7	123	0.299	0.325	PFD4_SCHPO Probable prefoldin subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC227.05 PE=3 SV=1
7	Q14314	0.003	38.5	439	0.201	0.062	FGL2_HUMAN Fibroleukin OS=Homo sapiens OX=9606 GN=FGL2 PE=1 SV=1
8	Q99NH0	0.13	33.9	2603	0.216	0.011	ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus OX=10090 GN=Ankrd17 PE=1 SV=2
9	H0YM23	0.16	33.5	2487	0.216	0.012	H0YM23_HUMAN Ankyrin repeat domain 17 (Fragment) OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=1
10	O75179	0.20	33.5	2603	0.216	0.011	ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17 PE=1 SV=3
11	Q91349	0.26	33.1	547	0.284	0.069	Q91349_XENLA IL4I1 protein OS=Xenopus laevis OX=8355 GN=nup62.L PE=1 SV=1
12	Q8MIP7	0.32	32.7	442	0.179	0.054	Q8MIP7_PIG Fibrinogen-like protein 2 OS=Sus scrofa OX=9823 GN=FGL2 PE=4 SV=1
13	Q8MSG8	0.44	32.3	662	0.142	0.029	APTX_DROME Aprataxin-like protein OS=Drosophila melanogaster OX=7227 GN=CG5316 PE=2 SV=2
14	Q32Q89	0.49	32.0	427	0.172	0.054	Q32Q89_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
15	G3V7P2	0.50	32.0	429	0.172	0.054	G3V7P2_RAT Fibrinogen-like 2 OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=4 SV=1
16	F1MMT2	0.62	32.0	1964	0.179	0.012	F1MMT2_BOVIN Laminin subunit alpha 2 OS=Bos taurus OX=9913 GN=LAMA2 PE=4 SV=3
17	Q5U3X5	0.63	32.0	422	0.172	0.055	Q5U3X5_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
18	Q6IN12	0.73	31.6	419	0.172	0.055	Q6IN12_RAT Fgl2 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Fgl2 PE=2 SV=1
19	Q58ER5	0.75	31.6	744	0.127	0.023	Q58ER5_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=zgc:113099 PE=2 SV=1
20	F1QFW2	0.87	31.6	744	0.127	0.023	F1QFW2_DANRE RING-type E3 ubiquitin transferase OS=Danio rerio OX=7955 GN=trim2 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13476 AAA_23	2.1e+02	13.8	AAA domain
2	PF16326 ABC_tran_CTD	4e+02	12.7	ABC transporter C-terminal domain
3	PF14962 AIF-MLS	2.3e+02	13.0	Mitochondria Localisation Sequence
4	PF17675 APG6_N	80	15.1	Apg6 coiled-coil region
5	PF10211 Ax_dynein_light	8.2e+02	11.3	Axonemal dynein light chain
6	PF17324 BLI1	61	15.7	BLOC-1 interactor 1
7	PF18822 CdvA	98	14.5	CdvA-like coiled-coil domain
8	PF14197 Cep57_CLD_2	36	15.8	Centrosome localisation domain of PPC89
9	PF08653 DASH_Dam1	7.7e+02	11.3	DASH complex subunit Dam1
10	PF04977 DivIC	49	15.1	Septum formation initiator
11	PF05103 DivIVA	83	14.6	DivIVA protein
12	PF07870 DUF1657	5.3e+02	11.9	Protein of unknown function (DUF1657)
13	PF07889 DUF1664	36	15.8	Protein of unknown function (DUF1664)
14	PF10704 DUF2508	9.4e+02	11.4	Protein of unknown function (DUF2508)
15	PF11026 DUF2721	1.5e+02	13.6	Protein of unknown function (DUF2721)
16	PF13600 DUF4140	20	17.1	N-terminal domain of unknown function (DUF4140)
17	PF16146 DUF4854	13	17.5	Domain of unknown function (DUF4854)
18	PF16378 DUF4988	5.8e+02	11.5	Domain of unknown function
19	PF16888 DUF5082	2.6	19.8	Domain of unknown function (DUF5082)
20	PF17253 DUF5320	51	16.5	Family of unknown function (DUF5320)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008567810.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008572535.1	0.999	Prefoldin subunit 1
2	482537.XP_008578435.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 11 mRNAs, 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
3	482537.XP_008580053.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
4	482537.XP_008589297.1	0.999	Prefoldin subunit 3
5	482537.XP_008573071.1	0.998	Prefoldin subunit 5 isoform X1
6	482537.XP_008573819.1	0.998	Prefoldin subunit 5 isoform X1
7	482537.XP_008575665.1	0.907	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 7 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
8	482537.XP_008575604.1	0.880	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 7 mRNAs, 5 Proteins, and 84% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
9	482537.XP_008579048.1	0.865	Proteasome subunit beta type-3
10	482537.XP_008589785.1	0.792	T-complex protein 1 subunit theta
11	482537.XP_008568801.1	0.780	T-complex protein 1 subunit gamma
12	482537.XP_008569383.1	0.780	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 2 bases in 1 codon
13	482537.XP_008586788.1	0.780	T-complex protein 1 subunit beta
14	482537.XP_008583560.1	0.766	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
15	482537.XP_008583649.1	0.766	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 19 mRNAs, 18 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
16	482537.XP_008585238.1	0.764	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 13 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
17	482537.XP_008587661.1	0.764	Proteasome subunit alpha type-2
18	482537.XP_008575410.1	0.760	P53 and DNA damage-regulated protein 1
19	482537.XP_008572757.1	0.718	Proteasome subunit alpha type-4
20	482537.XP_008570852.1	0.701	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 mRNAs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051082	0.998	unfolded protein binding
GO:0001540	0.993	amyloid-beta binding
GO:0051087	0.976	chaperone binding
GO:0015631	0.459	tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051128	0.995	regulation of cellular component organization
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:1902903	0.993	regulation of supramolecular fiber organization
GO:0048519	0.991	negative regulation of biological process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051246	0.982	regulation of protein metabolic process
GO:1902904	0.976	negative regulation of supramolecular fiber organization
GO:0051248	0.969	negative regulation of protein metabolic process
GO:0006457	0.704	protein folding
GO:0008152	0.406	metabolic process
GO:0006807	0.387	nitrogen compound metabolic process
GO:0071704	0.386	organic substance metabolic process
GO:0044238	0.371	primary metabolic process
GO:0043170	0.342	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0032991	0.995	protein-containing complex
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0005829	0.988	cytosol
GO:0005634	0.987	nucleus
GO:0005739	0.776	mitochondrion
GO:0043232	0.355	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]