StarFunc result for job id Q9NQR1

User Input

>input (393 residues)
MGEGGAAAALVAAAAAAAAAAAAVVAGQRRRRLGRRARCHGPGRAAGGKMSKPCAVEAAA
AAVAATAPGPEMVERRGPGRPRTDGENVFTGQSKIYSYMSPNKCSGMRFPLQEENSVTHH
EVKCQGKPLAGIYRKREEKRNAGNAVRSAMKSEEQKIKDARKGPLVPFPNQKSEAAEPPK
TPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQ
SEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDLIEITDAKKRE
ALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKLHDIDGVPHLI
LIASRDIAAGEELLYDYGDRSKASIEAHPWLKH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQR1	0.999	0.999	1.209E-61	393	1.000	1.000	Q9NQR1.pdb.gz	KMT5A_HUMAN N-lysine methyltransferase KMT5A OS=Homo sapiens OX=9606 GN=KMT5A PE=1 SV=3
2	PDB:7td5A	0.306	0.245	1.100E-9	497	0.102	0.080	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
3	PDB:5hynA	0.305	0.210	2.523E-9	581	0.097	0.065	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
4	PDB:7td5F	0.306	0.271	3.014E-9	447	0.102	0.089	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
5	PDB:6wkrC	0.305	0.202	4.302E-9	606	0.097	0.063	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
6	PDB:5wg6A	0.284	0.218	8.258E-9	517	0.094	0.072	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
7	PDB:7ksoA	0.284	0.283	1.327E-8	395	0.102	0.101	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
8	AFDB:Q2LAE1	0.289	0.067	2.157E-8	1759	0.165	0.037	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
9	PDB:1pegA	0.284	0.412	3.672E-7	266	0.094	0.139	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
10	PDB:5h6zA	0.245	0.691	7.554E-6	123	0.059	0.187	5h6zA.pdb.gz
11	AFDB:Q8IRW8	0.308	0.055	1.101E-4	2431	0.112	0.018	Q8IRW8.pdb.gz	TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2
12	PDB:2g46A	0.236	0.646	1.380E-4	119	0.087	0.286	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
13	AFDB:O44757	0.264	0.083	2.526E-4	1312	0.178	0.053	O44757.pdb.gz	LIN59_CAEEL Probable histone-lysine N-methyltransferase lin-59 OS=Caenorhabditis elegans OX=6239 GN=lin-59 PE=2 SV=1
14	AFDB:A4LBC2	0.281	0.072	3.202E-4	1604	0.196	0.048	A4LBC2.pdb.gz	A4LBC2_CAEEL Histone-lysine N-methyltransferase OS=Caenorhabditis elegans OX=6239 GN=met-1 PE=1 SV=1
15	PDB:5v3hA	0.243	0.220	2.376E-3	438	0.081	0.073	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
16	AFDB:A2ABF9	0.286	0.093	7.057E-2	1267	0.109	0.034	A2ABF9.pdb.gz	A2ABF9_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
17	AFDB:A8TT22	0.267	0.093	8.946E-2	1173	0.102	0.034	A8TT22.pdb.gz	A8TT22_DANRE Euchromatic histone lysine N-mthyltransferase EHMT2/G9a OS=Danio rerio OX=7955 GN=g9a PE=1 SV=1
18	AFDB:Q7KWS3	0.080	0.037	1.069E-1	979	0.117	0.047	Q7KWS3.pdb.gz	Q7KWS3_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnA PE=3 SV=1
19	AFDB:A2ABF8	0.286	0.095	1.355E-1	1233	0.112	0.036	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
20	AFDB:Q9I7V0	0.076	0.029	7.562E-1	1241	0.158	0.050	Q9I7V0.pdb.gz	Q9I7V0_DROME Mid1, isoform A OS=Drosophila melanogaster OX=7227 GN=Mid1 PE=2 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JKQ0	0.0	551	299	0.674	0.886	C9JKQ0_HUMAN [histone H4]-lysine(20) N-methyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=KMT5A PE=1 SV=1
2	Q9NQR1	0.0	808	393	1.000	1.000	KMT5A_HUMAN N-lysine methyltransferase KMT5A OS=Homo sapiens OX=9606 GN=KMT5A PE=1 SV=3
3	Q071E0	2.08e-103	311	344	0.369	0.422	KT5AA_DANRE N-lysine methyltransferase KMT5A-A OS=Danio rerio OX=7955 GN=kmt5aa PE=2 SV=1
4	Q9VFK6	4.13e-59	205	691	0.252	0.143	KMT5A_DROME Histone-lysine N-methyltransferase Set8 OS=Drosophila melanogaster OX=7227 GN=Set8 PE=1 SV=2
5	Q22795	3.04e-48	166	242	0.214	0.347	SET1_CAEEL Histone-lysine N-methyltransferase set-1 OS=Caenorhabditis elegans OX=6239 GN=set-1 PE=1 SV=2
6	G8JY06	3.76e-29	111	105	0.137	0.514	G8JY06_CAEEL SET domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=set-1 PE=4 SV=1
7	A8VKP8	1.91e-16	84.0	4218	0.112	0.010	A8VKP8_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
8	F1QL52	1.96e-16	84.0	4219	0.112	0.010	F1QL52_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
9	P20659	3.05e-16	83.6	3726	0.122	0.013	TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster OX=7227 GN=trx PE=1 SV=4
10	F1M0L3	7.07e-16	82.4	3986	0.109	0.011	F1M0L3_RAT Histone-lysine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2a PE=1 SV=4
11	P55200	7.26e-16	82.4	3966	0.109	0.011	KMT2A_MOUSE Histone-lysine N-methyltransferase 2A OS=Mus musculus OX=10090 GN=Kmt2a PE=1 SV=3
12	Q03164	8.77e-16	82.0	3969	0.109	0.011	KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5
13	Q9UMN6	2.21e-13	74.3	2715	0.104	0.015	KMT2B_HUMAN Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1
14	O08550	2.41e-13	74.3	2713	0.104	0.015	KMT2B_MOUSE Histone-lysine N-methyltransferase 2B OS=Mus musculus OX=10090 GN=Kmt2b PE=1 SV=3
15	P0CB22	4.11e-13	73.6	1083	0.112	0.041	ATX2_ARATH Histone-lysine N-methyltransferase ATX2 OS=Arabidopsis thaliana OX=3702 GN=ATX2 PE=1 SV=1
16	Q9C5X4	3.85e-12	70.5	1062	0.107	0.040	ATX1_ARATH Histone H3-lysine(4) N-trimethyltransferase ATX1 OS=Arabidopsis thaliana OX=3702 GN=ATX1 PE=1 SV=2
17	O54864	7.62e-12	68.6	412	0.109	0.104	SUV91_MOUSE Histone-lysine N-methyltransferase SUV39H1 OS=Mus musculus OX=10090 GN=Suv39h1 PE=1 SV=1
18	Q6DGD3	8.39e-12	68.6	411	0.125	0.119	SV91A_DANRE Histone-lysine N-methyltransferase SUV39H1-A OS=Danio rerio OX=7955 GN=suv39h1a PE=2 SV=2
19	Q9Y7R4	1.21e-11	68.9	920	0.094	0.040	SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set1 PE=1 SV=1
20	O43463	1.31e-11	67.8	412	0.109	0.104	SUV91_HUMAN Histone-lysine N-methyltransferase SUV39H1 OS=Homo sapiens OX=9606 GN=SUV39H1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18930 DUF5679	1.1e+02	14.4	Domain of unknown function (DUF5679)
2	PF20070 DUF6466	1.9e+02	13.9	Family of unknown function (DUF6466)
3	PF00856 SET	8.9e-16	70.2	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244537	0.984	Histone cluster 1 H4 family member f
2	9606.ENSP00000269305	0.970	Cellular tumor antigen p53
3	9606.ENSP00000332194	0.964	Histone H2A type 2-C
4	9606.ENSP00000367034	0.963	Histone cluster 1 H4 family member c
5	9606.ENSP00000350676	0.958	Histone lysine demethylase PHF8
6	9606.ENSP00000358151	0.956	Histone H2B type 2-E
7	9606.ENSP00000296417	0.953	Histone H2A.Z
8	9606.ENSP00000368458	0.953	Proliferating cell nuclear antigen
9	9606.ENSP00000398516	0.953	Lethal(3)malignant brain tumor-like protein 1
10	9606.ENSP00000355958	0.952	Denticleless protein homolog
11	9606.ENSP00000308405	0.943	Histone H2A.V
12	9606.ENSP00000434024	0.935	Histone H2AX
13	9606.ENSP00000355657	0.924	Histone H3.1t
14	9606.ENSP00000328484	0.920	Histone H2A type 1-J
15	9606.ENSP00000341094	0.920	Histone H2A type 1-D
16	9606.ENSP00000367022	0.920	Histone H2A type 1-C
17	9606.ENSP00000438553	0.920	Histone H2A.J
18	9606.ENSP00000484261	0.920	Histone H2A-Bbd type 1
19	9606.ENSP00000274764	0.910	Histone H2B type 1-A
20	9606.ENSP00000349430	0.909	Histone H2B type 1-K

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002039	1.000	p53 binding
GO:0140939	1.000	histone H4 methyltransferase activity
GO:0018024	1.000	histone lysine N-methyltransferase activity
GO:0003714	0.999	transcription corepressor activity
GO:0042799	0.569	histone H4K20 methyltransferase activity
GO:1901363	0.416	heterocyclic compound binding
GO:0003676	0.410	nucleic acid binding
GO:0140938	0.342	histone H3 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0044238	0.989	primary metabolic process
GO:0071704	0.985	organic substance metabolic process
GO:0009987	0.982	cellular process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0036211	0.977	protein modification process
GO:0080090	0.956	regulation of primary metabolic process
GO:0048519	0.954	negative regulation of biological process
GO:0044237	0.944	cellular metabolic process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0006479	0.925	protein methylation
GO:0031323	0.924	regulation of cellular metabolic process
GO:0048523	0.897	negative regulation of cellular process
GO:0010605	0.896	negative regulation of macromolecule metabolic process
GO:0018193	0.891	peptidyl-amino acid modification
GO:0019219	0.890	regulation of nucleobase-containing compound metabolic process
GO:0016043	0.888	cellular component organization
GO:0048583	0.887	regulation of response to stimulus
GO:0010468	0.886	regulation of gene expression
GO:0006355	0.880	regulation of DNA-templated transcription
GO:1901796	0.873	regulation of signal transduction by p53 class mediator
GO:0018205	0.863	peptidyl-lysine modification
GO:0140014	0.845	mitotic nuclear division
GO:0051172	0.842	negative regulation of nitrogen compound metabolic process
GO:0031324	0.840	negative regulation of cellular metabolic process
GO:0045934	0.826	negative regulation of nucleobase-containing compound metabolic process
GO:0030261	0.815	chromosome condensation
GO:0006357	0.807	regulation of transcription by RNA polymerase II
GO:0098813	0.790	nuclear chromosome segregation
GO:0045892	0.765	negative regulation of DNA-templated transcription
GO:2001020	0.763	regulation of response to DNA damage stimulus
GO:0018022	0.745	peptidyl-lysine methylation
GO:0000070	0.685	mitotic sister chromatid segregation
GO:0043516	0.601	regulation of DNA damage response, signal transduction by p53 class mediator
GO:0048518	0.421	positive regulation of biological process
GO:0050896	0.361	response to stimulus
GO:0000122	0.356	negative regulation of transcription by RNA polymerase II
GO:0007076	0.300	mitotic chromosome condensation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0043232	0.842	intracellular non-membrane-bounded organelle
GO:0000785	0.567	chromatin
GO:0032991	0.466	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:51736	1.000	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]