StarFunc result for job id Q9NQT4

User Input

>input (235 residues)
MEEETHTDAKIRAENGTGSSPRGPGCSLRHFACEQNLLSRPDGSASFLQGDTSVLAGVYG
PAEVKVSKEIFNKATLEVILRPKIGLPGVAEKSRERLIRNTCEAVVLGTLHPRTSITVVL
QVVSDAGSLLACCLNAACMALVDAGVPMRALFCGVACALDSDGTLVLDPTSKQEKEARAV
LTFALDSVERKLLMSSTKGLYSDTELQQCLAAAQAASQHVFRFYRESLQRRYSKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQT4	1.000	1.000	9.311E-50	235	1.000	1.000	Q9NQT4.pdb.gz	EXOS5_HUMAN Exosome complex component RRP46 OS=Homo sapiens OX=9606 GN=EXOSC5 PE=1 SV=1
2	AFDB:Q9CRA8	0.935	0.935	7.068E-46	235	0.894	0.894	Q9CRA8.pdb.gz	EXOS5_MOUSE Exosome complex component RRP46 OS=Mus musculus OX=10090 GN=Exosc5 PE=1 SV=1
3	PDB:6h25D	0.878	0.981	6.177E-38	210	0.889	0.995	6h25D.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
4	AFDB:Q95TW1	0.894	0.901	6.201E-28	233	0.336	0.339	Q95TW1.pdb.gz	Q95TW1_DROME GM01970p OS=Drosophila melanogaster OX=7227 GN=Rrp46 PE=2 SV=1
5	AFDB:Q84T68	0.853	0.843	1.171E-26	238	0.345	0.340	Q84T68.pdb.gz	EXOS5_ORYSJ Exosome complex exonuclease RRP46 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=RRP46 PE=1 SV=2
6	PDB:3hkmB	0.838	0.922	3.919E-24	213	0.336	0.371	3hkmB.pdb.gz
7	AFDB:G5EG59	0.844	0.925	3.405E-23	214	0.277	0.304	G5EG59.pdb.gz	EXOS5_CAEEL Exosome complex component RRP46 homolog OS=Caenorhabditis elegans OX=6239 GN=crn-5 PE=1 SV=1
8	AFDB:P53256	0.847	0.891	5.181E-23	223	0.255	0.269	P53256.pdb.gz	RRP46_YEAST Exosome complex component RRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP46 PE=1 SV=2
9	AFDB:Q9UXC2	0.855	0.811	5.181E-23	248	0.281	0.266	Q9UXC2.pdb.gz	RRP41_SACS2 Exosome complex component Rrp41 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rrp41 PE=1 SV=1
10	PDB:5jeaD	0.848	0.889	4.472E-22	224	0.255	0.268	5jeaD.pdb.gz	Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
11	AFDB:Q921I9	0.859	0.825	4.765E-22	245	0.255	0.245	Q921I9.pdb.gz	EXOS4_MOUSE Exosome complex component RRP41 OS=Mus musculus OX=10090 GN=Exosc4 PE=1 SV=3
12	AFDB:A2RVK7	0.843	0.776	2.554E-21	256	0.196	0.180	A2RVK7.pdb.gz	RP41L_ARATH Exosome complex component RRP41-like OS=Arabidopsis thaliana OX=3702 GN=RRP41L PE=2 SV=1
13	PDB:2c39D	0.831	0.788	3.235E-21	248	0.260	0.246	2c39D.pdb.gz	Structural Basis of 3' End RNA Recognition and Exoribonucleolytic Cleavage by an Exosome Rnase Ph Core.
14	AFDB:O26779	0.863	0.846	3.886E-21	240	0.226	0.221	O26779.pdb.gz	RRP41_METTH Exosome complex component Rrp41 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=rrp41 PE=1 SV=1
15	PDB:2wnrB	0.834	0.882	1.449E-20	222	0.213	0.225	2wnrB.pdb.gz	Structure of the Methanothermobacter Thermautotrophicus Exosome Rnase Ph Ring
16	PDB:6d6qB	0.846	0.826	5.754E-20	241	0.247	0.241	6d6qB.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
17	PDB:6d6qF	0.832	0.777	4.162E-19	252	0.268	0.250	6d6qF.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
18	PDB:5c0xB	0.832	0.802	5.965E-19	244	0.221	0.213	5c0xB.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
19	PDB:2wp8B	0.818	0.883	3.968E-17	217	0.213	0.230	2wp8B.pdb.gz
20	PDB:4ba2A	0.768	0.663	6.411E-17	274	0.179	0.153	4ba2A.pdb.gz	Crystal Structure of a 9-Subunit Archaeal Exosome in Pre-Catalytic States of the Phosphorolytic Reaction.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQT4	3.71e-174	479	235	1.000	1.000	EXOS5_HUMAN Exosome complex component RRP46 OS=Homo sapiens OX=9606 GN=EXOSC5 PE=1 SV=1
2	M0R102	1.26e-168	466	257	1.000	0.914	M0R102_HUMAN Exosome component 5 OS=Homo sapiens OX=9606 GN=EXOSC5 PE=1 SV=9
3	Q9CRA8	7.67e-144	403	235	0.894	0.894	EXOS5_MOUSE Exosome complex component RRP46 OS=Mus musculus OX=10090 GN=Exosc5 PE=1 SV=1
4	Q95TW1	4.31e-46	155	233	0.340	0.343	Q95TW1_DROME GM01970p OS=Drosophila melanogaster OX=7227 GN=Rrp46 PE=2 SV=1
5	Q9VGZ2	1.48e-45	153	233	0.340	0.343	Q9VGZ2_DROME FI06805p OS=Drosophila melanogaster OX=7227 GN=Rrp46 PE=1 SV=3
6	Q84T68	2.20e-42	145	238	0.345	0.340	EXOS5_ORYSJ Exosome complex exonuclease RRP46 homolog OS=Oryza sativa subsp. japonica OX=39947 GN=RRP46 PE=1 SV=2
7	G5EG59	6.71e-27	104	214	0.281	0.308	EXOS5_CAEEL Exosome complex component RRP46 homolog OS=Caenorhabditis elegans OX=6239 GN=crn-5 PE=1 SV=1
8	O42894	5.50e-25	100	226	0.268	0.279	RRP46_SCHPO Exosome complex component rrp46 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp46 PE=3 SV=1
9	Q9UXC2	4.13e-23	95.9	248	0.311	0.294	RRP41_SACS2 Exosome complex component Rrp41 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rrp41 PE=1 SV=1
10	P53256	8.62e-22	91.7	223	0.260	0.274	RRP46_YEAST Exosome complex component RRP46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP46 PE=1 SV=2
11	Q921I9	3.19e-21	90.9	245	0.285	0.273	EXOS4_MOUSE Exosome complex component RRP41 OS=Mus musculus OX=10090 GN=Exosc4 PE=1 SV=3
12	Q9NPD3	2.36e-20	88.6	245	0.281	0.269	EXOS4_HUMAN Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3
13	O42872	5.32e-19	84.7	242	0.264	0.256	RRP41_SCHPO Exosome complex component ski6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski6 PE=2 SV=1
14	O26779	1.15e-16	78.2	240	0.272	0.267	RRP41_METTH Exosome complex component Rrp41 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) OX=187420 GN=rrp41 PE=1 SV=1
15	Q9VK19	3.44e-15	74.3	246	0.238	0.228	Q9VK19_DROME FI07225p OS=Drosophila melanogaster OX=7227 GN=Ski6 PE=1 SV=1
16	Q8SYC8	3.80e-15	74.3	246	0.226	0.215	Q8SYC8_DROME RE67757p OS=Drosophila melanogaster OX=7227 GN=Ski6 PE=2 SV=1
17	E9PI41	2.18e-13	69.7	261	0.179	0.161	E9PI41_HUMAN Exosome component 4 (Fragment) OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=8
18	P46948	2.73e-10	60.8	246	0.238	0.228	RRP41_YEAST Exosome complex component SKI6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SKI6 PE=1 SV=1
19	Q38AL8	3.59e-09	57.8	252	0.187	0.175	Q38AL8_TRYB2 Exosome complex exonuclease RRP41A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.3210 PE=4 SV=1
20	Q95Z13	6.40e-09	57.0	252	0.174	0.163	Q95Z13_9TRYP Rrp41p homologue OS=Trypanosoma brucei OX=5691 GN=RRP41A PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01138 RNase_PH	4.1e-19	80.8	3' exoribonuclease family, domain 1
2	PF03725 RNase_PH_C	8.9e-05	33.8	3' exoribonuclease family, domain 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000221233

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230640	0.999	Superkiller viralicidic activity 2-like 2
2	9606.ENSP00000258169	0.999	M-phase phosphoprotein 6
3	9606.ENSP00000265564	0.999	Exosome complex component RRP42
4	9606.ENSP00000315476	0.999	Exosome complex component RRP41
5	9606.ENSP00000321711	0.999	DIS3-like exonuclease 1
6	9606.ENSP00000323046	0.999	Exosome complex component RRP40
7	9606.ENSP00000348107	0.999	Nuclear nucleic acid-binding protein C1D
8	9606.ENSP00000359939	0.999	Exosome complex component CSL4
9	9606.ENSP00000361433	0.999	Exosome complex component RRP4
10	9606.ENSP00000366135	0.999	Exosome component 10
11	9606.ENSP00000366997	0.999	Exosome complex exonuclease RRP44
12	9606.ENSP00000368984	0.999	Exosome complex component RRP45
13	9606.ENSP00000374354	0.999	Exosome complex component RRP43
14	9606.ENSP00000398597	0.999	Exosome complex component MTR3
15	9606.ENSP00000362105	0.994	Probable U3 small nucleolar RNA-associated protein 11
16	9606.ENSP00000259239	0.992	U3 small nucleolar ribonucleoprotein protein IMP4
17	9606.ENSP00000356811	0.988	HBS1-like protein
18	9606.ENSP00000297990	0.987	Nucleolar protein 6
19	9606.ENSP00000221801	0.985	rRNA 2'-O-methyltransferase fibrillarin
20	9606.ENSP00000328854	0.985	Nucleolar complex protein 4 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.736	catalytic activity
GO:0097159	0.566	organic cyclic compound binding
GO:1901363	0.564	heterocyclic compound binding
GO:0003676	0.419	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0006807	0.986	nitrogen compound metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:0006401	0.984	RNA catabolic process
GO:0065007	0.937	biological regulation
GO:0050789	0.884	regulation of biological process
GO:0050794	0.789	regulation of cellular process
GO:0010467	0.762	gene expression
GO:0010468	0.686	regulation of gene expression
GO:0016071	0.652	mRNA metabolic process
GO:0048518	0.641	positive regulation of biological process
GO:0048522	0.634	positive regulation of cellular process
GO:0006396	0.627	RNA processing
GO:0080090	0.620	regulation of primary metabolic process
GO:0031323	0.619	regulation of cellular metabolic process
GO:0051171	0.590	regulation of nitrogen compound metabolic process
GO:0019219	0.579	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.535	negative regulation of biological process
GO:0010605	0.512	negative regulation of macromolecule metabolic process
GO:0010604	0.461	positive regulation of macromolecule metabolic process
GO:0045935	0.441	positive regulation of nucleobase-containing compound metabolic process
GO:0051252	0.346	regulation of RNA metabolic process
GO:0010629	0.320	negative regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:1902494	0.998	catalytic complex
GO:0000178	0.965	exosome (RNase complex)
GO:0005829	0.960	cytosol
GO:0005694	0.947	chromosome
GO:0000785	0.769	chromatin
GO:0000791	0.711	euchromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]