StarFunc result for job id Q9NQT5

User Input

>input (275 residues)
MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARAC
SRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGI
VTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVC
IDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVK
AKTIQQTLILANILEACEHMTSDQRKQIFSRLAES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQT5	1.000	1.000	2.850E-58	275	1.000	1.000	Q9NQT5.pdb.gz	EXOS3_HUMAN Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3 PE=1 SV=3
2	AFDB:Q7TQK4	0.928	0.931	4.511E-50	274	0.873	0.876	Q7TQK4.pdb.gz	EXOS3_MOUSE Exosome complex component RRP40 OS=Mus musculus OX=10090 GN=Exosc3 PE=1 SV=3
3	PDB:6d6qG	0.842	0.975	1.151E-40	237	0.855	0.992	6d6qG.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
4	AFDB:A0A0R4IRK6	0.803	0.892	1.552E-36	247	0.553	0.615	A0A0R4IRK6.pdb.gz
5	AFDB:Q8IPX7	0.777	0.917	3.035E-30	232	0.360	0.427	Q8IPX7.pdb.gz	EXOS3_DROME Exosome complex component RRP40 OS=Drosophila melanogaster OX=7227 GN=Rrp40 PE=1 SV=1
6	AFDB:Q93830	0.741	0.897	8.655E-27	226	0.305	0.372	Q93830.pdb.gz	Q93830_CAEEL Ribosomal RNA-processing protein 40 OS=Caenorhabditis elegans OX=6239 GN=exos-3 PE=1 SV=1
7	AFDB:O13903	0.750	0.855	4.622E-25	240	0.280	0.321	O13903.pdb.gz	RRP40_SCHPO Exosome complex component rrp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp40 PE=3 SV=1
8	AFDB:Q08285	0.709	0.807	1.226E-22	240	0.258	0.296	Q08285.pdb.gz	RRP40_YEAST Exosome complex component RRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP40 PE=1 SV=2
9	PDB:7ajtEH	0.697	0.802	6.184E-20	237	0.269	0.312	7ajtEH.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
10	PDB:5okzQ	0.615	0.804	1.824E-18	207	0.218	0.290	5okzQ.pdb.gz	Mpp6 Incorporation in the Nuclear Exosome Contributes to RNA Channeling through the Mtr4 Helicase.
11	AFDB:Q38EN5	0.687	0.626	2.075E-18	304	0.229	0.207	Q38EN5.pdb.gz	Q38EN5_TRYB2 Exosome complex exonuclease RRP40 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5160 PE=4 SV=1
12	PDB:4ifdH	0.465	0.439	2.651E-12	295	0.171	0.159	4ifdH.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
13	AFDB:Q13868	0.473	0.448	3.201E-12	293	0.164	0.154	Q13868.pdb.gz	EXOS2_HUMAN Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2 PE=1 SV=2
14	AFDB:Q95XD0	0.488	0.449	3.605E-12	303	0.193	0.175	Q95XD0.pdb.gz	EXOS2_CAEEL Exosome complex component RRP4 homolog OS=Caenorhabditis elegans OX=6239 GN=exos-2 PE=2 SV=1
15	PDB:6d6qH	0.440	0.421	8.296E-11	289	0.153	0.145	6d6qH.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
16	PDB:6d6qI	0.352	0.486	7.755E-7	183	0.095	0.142	6d6qI.pdb.gz	Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.
17	PDB:4ifdI	0.377	0.440	1.509E-5	230	0.131	0.157	4ifdI.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
18	PDB:5jeaI	0.351	0.404	1.509E-5	235	0.109	0.128	5jeaI.pdb.gz	Structure of a Cytoplasmic 11-Subunit RNA Exosome Complex.
19	PDB:2c35B	0.227	0.350	4.724E-4	171	0.058	0.094	2c35B.pdb.gz
20	PDB:3h0gG	0.229	0.356	7.158E-4	170	0.065	0.106	3h0gG.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQT5	0.0	557	275	1.000	1.000	EXOS3_HUMAN Exosome complex component RRP40 OS=Homo sapiens OX=9606 GN=EXOSC3 PE=1 SV=3
2	Q7TQK4	3.84e-174	483	274	0.873	0.876	EXOS3_MOUSE Exosome complex component RRP40 OS=Mus musculus OX=10090 GN=Exosc3 PE=1 SV=3
3	Q4KMD2	6.31e-108	314	247	0.560	0.623	Q4KMD2_DANRE Ribosomal RNA-processing protein 40 OS=Danio rerio OX=7955 GN=zgc:112345 PE=1 SV=1
4	Q8IPX7	1.59e-65	206	232	0.335	0.397	EXOS3_DROME Exosome complex component RRP40 OS=Drosophila melanogaster OX=7227 GN=Rrp40 PE=1 SV=1
5	Q93830	1.97e-48	162	226	0.287	0.350	Q93830_CAEEL Ribosomal RNA-processing protein 40 OS=Caenorhabditis elegans OX=6239 GN=exos-3 PE=1 SV=1
6	O13903	5.46e-42	146	240	0.251	0.287	RRP40_SCHPO Exosome complex component rrp40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp40 PE=3 SV=1
7	Q08285	1.49e-32	121	240	0.244	0.279	RRP40_YEAST Exosome complex component RRP40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP40 PE=1 SV=2
8	Q38EN5	5.95e-11	63.9	304	0.251	0.227	Q38EN5_TRYB2 Exosome complex exonuclease RRP40 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5160 PE=4 SV=1
9	Q95Z14	5.95e-11	63.9	304	0.251	0.227	Q95Z14_9TRYP Rrp40p homologue OS=Trypanosoma brucei OX=5691 GN=RRP40 PE=4 SV=1
10	Q8CI15	0.19	35.4	382	0.062	0.045	SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus OX=10090 GN=Sphk1 PE=1 SV=1
11	P38792	0.37	34.3	359	0.055	0.042	RRP4_YEAST Exosome complex component RRP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RRP4 PE=1 SV=1
12	Q91V26	0.47	34.3	383	0.062	0.044	SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus OX=10116 GN=Sphk1 PE=1 SV=1
13	Q09704	1.3	32.7	329	0.167	0.140	RRP4_SCHPO Exosome complex component rrp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rrp4 PE=3 SV=1
14	A8R7K9	9.7	30.4	790	0.044	0.015	VP35C_ARATH Vacuolar protein sorting-associated protein 35C OS=Arabidopsis thaliana OX=3702 GN=VPS35C PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15985 KH_6	1.6e-11	55.8	KH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323046

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221233	0.999	Exosome complex component RRP46
2	9606.ENSP00000230640	0.999	Superkiller viralicidic activity 2-like 2
3	9606.ENSP00000258169	0.999	M-phase phosphoprotein 6
4	9606.ENSP00000265564	0.999	Exosome complex component RRP42
5	9606.ENSP00000315476	0.999	Exosome complex component RRP41
6	9606.ENSP00000321711	0.999	DIS3-like exonuclease 1
7	9606.ENSP00000348107	0.999	Nuclear nucleic acid-binding protein C1D
8	9606.ENSP00000359939	0.999	Exosome complex component CSL4
9	9606.ENSP00000361433	0.999	Exosome complex component RRP4
10	9606.ENSP00000366135	0.999	Exosome component 10
11	9606.ENSP00000366997	0.999	Exosome complex exonuclease RRP44
12	9606.ENSP00000368984	0.999	Exosome complex component RRP45
13	9606.ENSP00000374354	0.999	Exosome complex component RRP43
14	9606.ENSP00000398597	0.999	Exosome complex component MTR3
15	9606.ENSP00000356811	0.994	HBS1-like protein
16	9606.ENSP00000364639	0.973	RNA-binding protein 7
17	9606.ENSP00000368017	0.968	Zinc finger C3H1 domain-containing protein
18	9606.ENSP00000438993	0.959	Zinc finger CCHC domain-containing protein 8
19	9606.ENSP00000400646	0.955	Polyribonucleotide nucleotidyltransferase 1, mitochondrial
20	9606.ENSP00000364543	0.949	Helicase SKI2W

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.463	nucleic acid binding
GO:0003723	0.434	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0090304	0.985	nucleic acid metabolic process
GO:0080090	0.980	regulation of primary metabolic process
GO:0051171	0.980	regulation of nitrogen compound metabolic process
GO:0031323	0.979	regulation of cellular metabolic process
GO:0010467	0.976	gene expression
GO:0060255	0.945	regulation of macromolecule metabolic process
GO:0010468	0.936	regulation of gene expression
GO:0048518	0.917	positive regulation of biological process
GO:0048522	0.913	positive regulation of cellular process
GO:0019219	0.908	regulation of nucleobase-containing compound metabolic process
GO:0044260	0.902	cellular macromolecule metabolic process
GO:0045935	0.895	positive regulation of nucleobase-containing compound metabolic process
GO:0010604	0.890	positive regulation of macromolecule metabolic process
GO:0016070	0.882	RNA metabolic process
GO:1901361	0.881	organic cyclic compound catabolic process
GO:0034655	0.869	nucleobase-containing compound catabolic process
GO:0044265	0.786	cellular macromolecule catabolic process
GO:0031326	0.782	regulation of cellular biosynthetic process
GO:0048519	0.770	negative regulation of biological process
GO:0048523	0.753	negative regulation of cellular process
GO:0010556	0.751	regulation of macromolecule biosynthetic process
GO:0010605	0.749	negative regulation of macromolecule metabolic process
GO:0006401	0.732	RNA catabolic process
GO:0071840	0.730	cellular component organization or biogenesis
GO:1903311	0.714	regulation of mRNA metabolic process
GO:0031329	0.694	regulation of cellular catabolic process
GO:0051246	0.644	regulation of protein metabolic process
GO:0034660	0.636	ncRNA metabolic process
GO:0051254	0.623	positive regulation of RNA metabolic process
GO:0006396	0.608	RNA processing
GO:0031331	0.592	positive regulation of cellular catabolic process
GO:1903313	0.589	positive regulation of mRNA metabolic process
GO:0010608	0.586	post-transcriptional regulation of gene expression
GO:0031324	0.586	negative regulation of cellular metabolic process
GO:0051172	0.584	negative regulation of nitrogen compound metabolic process
GO:0061013	0.574	regulation of mRNA catabolic process
GO:0006259	0.557	DNA metabolic process
GO:0043487	0.523	regulation of RNA stability
GO:0022613	0.492	ribonucleoprotein complex biogenesis
GO:0034470	0.471	ncRNA processing
GO:0061014	0.454	positive regulation of mRNA catabolic process
GO:0050779	0.439	RNA destabilization
GO:0016071	0.430	mRNA metabolic process
GO:0034248	0.424	regulation of amide metabolic process
GO:2000112	0.423	regulation of cellular macromolecule biosynthetic process
GO:0010629	0.418	negative regulation of gene expression
GO:0016072	0.346	rRNA metabolic process
GO:0042254	0.343	ribosome biogenesis
GO:0032501	0.311	multicellular organismal process
GO:0032502	0.308	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1902494	0.999	catalytic complex
GO:0140513	0.999	nuclear protein-containing complex
GO:0005829	0.998	cytosol
GO:0005730	0.995	nucleolus
GO:0000176	0.990	nuclear exosome (RNase complex)
GO:0005694	0.959	chromosome
GO:0000791	0.825	euchromatin
GO:0000177	0.770	cytoplasmic exosome (RNase complex)

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]