StarFunc result for job id Q9NQT8

User Input

>input (1826 residues)
MGDSKVKVAVRIRPMNRRETDLHTKCVVDVDANKVILNPVNTNLSKGDARGQPKVFAYDH
CFWSMDESVKEKYAGQDIVFKCLGENILQNAFDGYNACIFAYGQTGSGKSYTMMGTADQP
GLIPRLCSGLFERTQKEENEEQSFKVEVSYMEIYNEKVRDLLDPKGSRQTLKVREHSVLG
PYVDGLSKLAVTSYKDIESLMSEGNKSRTVAATNMNEESSRSHAVFKITLTHTLYDVKSG
TSGEKVGKLSLVDLAGSERATKTGAAGDRLKEGSNINKSLTTLGLVISALADQSAGKNKN
KFVPYRDSVLTWLLKDSLGGNSKTAMVATVSPAADNYDETLSTLRYADRAKHIVNHAVVN
EDPNARIIRDLREEVEKLREQLTKAEAMKSPELKDRLEESEKLIQEMTVTWEEKLRKTEE
IAQERQKQLESLGISLQSSGIKVGDDKCFLVNLNADPALNELLVYYLKEHTLIGSANSQD
IQLCGMGILPEHCIIDITSEGQVMLTPQKNTRTFVNGSSVSSPIQLHHGDRILWGNNHFF
RLNLPKKKKKAEREDEDQDPSMKNENSSEQLDVDGDSSSEVSSEVNFNYEYAQMEVTMKA
LGSNDPMQSILNSLEQQHEEEKRSALERQRLMYEHELEQLRRRLSPEKQNCRSMDRFSFH
SPSAQQRLRQWAEEREATLNNSLMRLREQIVKANLLVREANYIAEELDKRTEYKVTLQIP
ASSLDANRKRGSLLSEPAIQVRRKGKGKQIWSLEKLDNRLLDMRDLYQEWKECEEDNPVI
RSYFKRADPFYDEQENHSLIGVANVFLESLFYDVKLQYAVPIINQKGEVAGRLHVEVMRL
SGDVGERIAGGDEVAEVSFEKETQENKLVCMVKILQATGLPQHLSHFVFCKYSFWDQQEP
VIVAPEVDTSSSSVSKEPHCMVVFDHCNEFSVNITEDFIEHLSEGALAIEVYGHKINDPR
KNPALWDLGIIQAKTRSLRDRWSEVTRKLEFWVQILEQNENGEYCPVEVISAKDVPTGGI
FQLRQGQSRRVQVEVKSVQESGTLPLMEECILSVGIGCVKVRPLRAPRTHETFHEEEEDM
DSYQDRDLERLRRKWLNALTKRQEYLDQQLQKLVSKRDKTEDDADREAQLLEMRLTLTEE
RNAVMVPSAGSGIPGAPAEWTPVPGMETHIPVIFLDLNADDFSSQDNLDDPEAGGWDATL
TGEEEEEFFELQIVKQHDGEVKAEASWDSAVHGCPQLSRGTPVDERLFLIVRVTVQLSHP
ADMQLVLRKRICVNVHGRQGFAQSLLKKMSHRSSIPGCGVTFEIVSNIPEDAQGVEEREA
LARMAANVENPASADSEAYIEKYLRSVLAVENLLTLDRLRQEVAVKEQLTGKGKLSRRSI
SSPNVNRLSGSRQDLIPSYSLGSNKGRWESQQDVSQTTVSRGIAPAPALSVSPQNNHSPD
PGLSNLAASYLNPVKSFVPQMPKLLKSLFPVRDEKRGKRPSPLAHQPVPRIMVQSASPDI
RVTRMEEAQPEMGPDVLVQTMGAPALKICDKPAKVPSPPPVIAVTAVTPAPEAQDGPPSP
LSEASSGYFSHSVSTATLSDALGPGLDAAAPPGSMPTAPEAEPEAPISHPPPPTAVPAEE
PPGPQQLVSPGRERPDLEAPAPGSPFRVRRVRASELRSFSRMLAGDPGCSPGAEGNAPAP
GAGGQALASDSEEADEVPEWLREGEFVTVGAHKTGVVRYVGPADFQEGTWVGVELDLPSG
KNDGSIGGKQYFRCNPGYGLLVRPSRVRRATGPVRRRSTGLRLGAPEARRSATLSGSATN
LASLTAALAKADRSHKNPENRKSWAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2K8Z9	0.435	0.431	0.000	1843	0.880	0.872	A0A0G2K8Z9.pdb.gz	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
2	AFDB:Q9EQW7	0.395	0.411	0.000	1749	0.547	0.571	Q9EQW7.pdb.gz	KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus OX=10090 GN=Kif13a PE=1 SV=1
3	AFDB:Q9H1H9	0.387	0.391	0.000	1805	0.550	0.557	Q9H1H9.pdb.gz	KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2
4	AFDB:Q9NQT8	1.000	1.000	0.000	1826	1.000	1.000	Q9NQT8.pdb.gz	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
5	PDB:7wrgA	0.256	0.545	7.551E-64	812	0.163	0.366	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
6	PDB:7wrgB	0.249	0.551	6.338E-62	783	0.164	0.382	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
7	PDB:4h1gA	0.154	0.405	5.565E-23	670	0.062	0.170	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
8	AFDB:Q5T7B8	0.167	0.221	1.090E-22	1368	0.143	0.192	Q5T7B8.pdb.gz	KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens OX=9606 GN=KIF24 PE=1 SV=2
9	AFDB:Q52KG5	0.169	0.164	5.593E-18	1881	0.153	0.148	Q52KG5.pdb.gz	KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2
10	AFDB:Q9ULI4	0.171	0.166	2.577E-17	1882	0.154	0.150	Q9ULI4.pdb.gz	KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3
11	AFDB:Q57UP1	0.159	0.311	7.342E-15	894	0.067	0.136	Q57UP1.pdb.gz	Q57UP1_TRYB2 Kinesin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.480 PE=3 SV=1
12	PDB:2ff4A	0.050	0.234	1.681E-7	379	0.028	0.137	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
13	PDB:7dvqX	0.050	0.538	1.562E-5	156	0.012	0.135	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
14	PDB:2kb3A	0.051	0.570	4.551E-5	143	0.013	0.161	2kb3A.pdb.gz
15	PDB:5z56X	0.050	0.524	1.232E-2	159	0.007	0.082	5z56X.pdb.gz	Structure of the human activated spliceosome in three conformational states.
16	PDB:2kfuA	0.055	0.464	2.514E-2	162	0.013	0.148	2kfuA.pdb.gz
17	AFDB:Q583Q4	0.032	0.054	5.734E-2	880	0.041	0.085	Q583Q4.pdb.gz	Q583Q4_TRYB2 BRCT domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.5F5.320 PE=4 SV=1
18	AFDB:A0A2R8RMH2	0.033	0.047	6.349E-2	1150	0.061	0.097	A0A2R8RMH2.pdb.gz
19	PDB:6wskA	0.026	0.141	8.978E-2	287	0.009	0.056	6wskA.pdb.gz
20	PDB:5kynA	0.037	0.071	1.572E-1	730	0.018	0.045	5kynA.pdb.gz	TANGO1/cTAGE5 receptor as a polyvalent template for assembly of large COPII coats.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0B4KFR5	1462	1957	0.421	0.392	A0A0B4KFR5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
2	A0A0B4KG24	1419	1908	0.401	0.384	A0A0B4KG24_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
3	A0A0B4LGK5	1457	1913	0.420	0.401	A0A0B4LGK5_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
4	A0A0G2K8Z9	3046	1815	0.852	0.857	A0A0G2K8Z9_RAT Kinesin family member 13B OS=Rattus norvegicus OX=10116 GN=Kif13b PE=1 SV=2
5	A0A8I6A6V5	608	1697	0.216	0.233	A0A8I6A6V5_RAT Kinesin family member 1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=1
6	A1ZA18	1454	1921	0.421	0.400	A1ZA18_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
7	A1ZAJ2	623	1670	0.212	0.232	KIF1A_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=unc-104 PE=1 SV=1
8	A4UZI0	1463	1899	0.421	0.404	A4UZI0_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=1 SV=1
9	E9Q4K7	3283	1843	0.890	0.882	E9Q4K7_MOUSE Kinesin family member 13B OS=Mus musculus OX=10090 GN=Kif13b PE=1 SV=1
10	E9QDE5	611	1763	0.208	0.216	E9QDE5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
11	F1M4A4	606	1707	0.216	0.231	KIF1A_RAT Kinesin-like protein KIF1A OS=Rattus norvegicus OX=10116 GN=Kif1a PE=1 SV=3
12	F1QBV5	612	1770	0.208	0.215	F1QBV5_DANRE Kinesin family member 1B OS=Danio rerio OX=7955 GN=unm_st43 PE=1 SV=1
13	O01349	1452	1921	0.421	0.400	O01349_DROME Kinesin-like protein unc-104 OS=Drosophila melanogaster OX=7227 GN=Khc-73 PE=2 SV=1
14	P23678	640	1584	0.238	0.275	UN104_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=unc-104 PE=1 SV=4
15	P33173	607	1695	0.216	0.233	KIF1A_MOUSE Kinesin-like protein KIF1A OS=Mus musculus OX=10090 GN=Kif1a PE=1 SV=2
16	Q12756	607	1690	0.216	0.234	KIF1A_HUMAN Kinesin-like protein KIF1A OS=Homo sapiens OX=9606 GN=KIF1A PE=1 SV=2
17	Q20888	1155	1561	0.359	0.420	Q20888_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=klp-4 PE=1 SV=3
18	Q8MQ20	1155	1576	0.359	0.416	Q8MQ20_CAEEL Kinesin-like protein unc-104 OS=Caenorhabditis elegans OX=6239 GN=klp-4 PE=1 SV=2
19	Q9EQW7	1851	1749	0.531	0.555	KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus OX=10090 GN=Kif13a PE=1 SV=1
20	Q9H1H9	1855	1805	0.531	0.537	KI13A_HUMAN Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01302 CAP_GLY	4.3e-20	82.7	CAP-Gly domain
2	PF12473 DUF3694	3e-19	81.4	Kinesin protein
3	PF00498 FHA	9e-06	37.3	FHA domain
4	PF12423 KIF1B	1.7e-12	58.7	Kinesin protein 1B
5	PF00225 Kinesin	9.4e-114	391.4	Kinesin motor domain
6	PF16183 Kinesin_assoc	2.5e-23	94.7	Kinesin-associated
7	PF16796 Microtub_bd	2.7e-21	87.6	Microtubule binding
8	PF16697 Yop-YscD_cpl	0.09	24.4	Inner membrane component of T3SS, cytoplasmic domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427900

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442682	0.999	Arf-GAP with dual PH domain-containing protein 1
2	9606.ENSP00000345731	0.990	Disks large homolog 1
3	9606.ENSP00000382428	0.964	Disks large homolog 4
4	9606.ENSP00000298316	0.948	ADP-ribosylation factor 6
5	9606.ENSP00000355689	0.833	Guanylate kinase
6	9606.ENSP00000459962	0.769	Transient receptor potential cation channel, subfamily V, member 1
7	9606.ENSP00000263923	0.731	Vascular endothelial growth factor receptor 2
8	9606.ENSP00000354560	0.699	Kinesin-associated protein 3
9	9606.ENSP00000260363	0.692	Kinesin-like protein KIF23
10	9606.ENSP00000367398	0.687	Nephrocystin-4
11	9606.ENSP00000381104	0.681	Transmembrane 9 superfamily member 4
12	9606.ENSP00000414982	0.661	Kinesin light chain 1
13	9606.ENSP00000408979	0.622	Kinesin heavy chain isoform 5A
14	9606.ENSP00000259708	0.619	Kinesin light chain 4
15	9606.ENSP00000385751	0.618	Serine/threonine-protein kinase MARK2
16	9606.ENSP00000307078	0.615	Kinesin-1 heavy chain
17	9606.ENSP00000363480	0.610	Disks large homolog 3
18	9606.ENSP00000404190	0.610	Rac GTPase-activating protein 1
19	9606.ENSP00000260731	0.606	Kinesin-like protein KIF11
20	9606.ENSP00000265148	0.599	Centromere-associated protein E

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019900	0.987	kinase binding
GO:0003774	0.950	cytoskeletal motor activity
GO:0019901	0.895	protein kinase binding
GO:0071889	0.746	14-3-3 protein binding
GO:0140657	0.676	ATP-dependent activity
GO:0003777	0.652	microtubule motor activity
GO:0008092	0.611	cytoskeletal protein binding
GO:0042802	0.416	identical protein binding
GO:0015631	0.324	tubulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051234	0.992	establishment of localization
GO:0051641	0.992	cellular localization
GO:0050789	0.978	regulation of biological process
GO:0050794	0.971	regulation of cellular process
GO:0007017	0.939	microtubule-based process
GO:0051649	0.922	establishment of localization in cell
GO:0006810	0.911	transport
GO:0016043	0.818	cellular component organization
GO:0033036	0.794	macromolecule localization
GO:0046907	0.770	intracellular transport
GO:0070727	0.694	cellular macromolecule localization
GO:0007018	0.599	microtubule-based movement
GO:0008104	0.596	protein localization
GO:0006996	0.583	organelle organization
GO:0051128	0.504	regulation of cellular component organization
GO:0006886	0.473	intracellular protein transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043227	0.979	membrane-bounded organelle
GO:0016020	0.978	membrane
GO:0043232	0.976	intracellular non-membrane-bounded organelle
GO:0005829	0.964	cytosol
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0015630	0.922	microtubule cytoskeleton
GO:0012505	0.900	endomembrane system
GO:0042995	0.826	cell projection
GO:0120025	0.738	plasma membrane bounded cell projection
GO:0031982	0.654	vesicle
GO:0043005	0.558	neuron projection
GO:0099080	0.455	supramolecular complex
GO:0005874	0.380	microtubule
GO:0030424	0.374	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]