StarFunc result for job id Q9NQV5

User Input

>input (511 residues)
MLKMAEPIASLMIVECRACLRCSPLFLYQREKDRMTENMKECLAQTNAAVGDMVTVVKTE
VCSPLRDQEYGQPCSRRPDSSAMEVEPKKLKGKRDLIVPKSFQQVDFWFCESCQEYFVDE
CPNHGPPVFVSDTPVPVGIPDRAALTIPQGMEVVKDTSGESDVRCVNEVIPKGHIFGPYE
GQISTQDKSAGFFSWLIVDKNNRYKSIDGSDETKANWMRYVVISREEREQNLLAFQHSER
IYFRACRDIRPGEWLRVWYSEDYMKRLHSMSQETIHRNLARGEKRLQREKSEQVLDNPED
LRGPIHLSVLRQGKSPYKRGFDEGDVHPQAKKKKIDLIFKDVLEASLESAKVEAHQLALS
TSLVIRKVPKYQDDAYSQCATTMTHGVQNIGQTQGEGDWKVPQGVSKEPGQLEDEEEEPS
SFKADSPAEASLASDPHELPTTSFCPNCIRLKKKVRELQAELDMLKSGKLPEPPVLPPQV
LELPEFSDPAGKLVWMRLLSEGRVRSGLCGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQV5	1.000	1.000	9.649E-88	511	1.000	1.000	Q9NQV5.pdb.gz	PRD11_HUMAN PR domain-containing protein 11 OS=Homo sapiens OX=9606 GN=PRDM11 PE=1 SV=2
2	AFDB:A2AGX3	0.442	0.403	3.021E-69	565	0.822	0.743	A2AGX3.pdb.gz	PRD11_MOUSE PR domain-containing protein 11 OS=Mus musculus OX=10090 GN=Prdm11 PE=1 SV=1
3	AFDB:Q5MB23	0.260	0.174	5.302E-16	776	0.178	0.117	Q5MB23.pdb.gz
4	AFDB:Q13029	0.228	0.071	1.820E-12	1718	0.141	0.042	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
5	AFDB:A2A7B5	0.242	0.078	3.144E-12	1709	0.151	0.045	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
6	AFDB:F1QJD2	0.207	0.119	1.681E-5	976	0.119	0.062	F1QJD2.pdb.gz
7	AFDB:Q10362	0.158	0.101	3.935E-5	859	0.125	0.075	Q10362.pdb.gz	SET3_SCHPO SET domain-containing protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set3 PE=1 SV=1
8	PDB:1pegA	0.170	0.309	2.450E-4	266	0.045	0.086	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
9	PDB:5h6zA	0.164	0.599	3.319E-4	123	0.033	0.138	5h6zA.pdb.gz
10	PDB:5hynA	0.171	0.151	5.396E-4	581	0.049	0.043	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
11	PDB:5wg6A	0.171	0.170	5.735E-4	517	0.047	0.046	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
12	PDB:7td5F	0.174	0.198	1.053E-3	447	0.059	0.067	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
13	PDB:6wkrC	0.172	0.146	1.342E-3	606	0.051	0.043	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
14	PDB:7td5A	0.173	0.177	1.516E-3	497	0.057	0.058	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:2g46A	0.164	0.558	2.183E-3	119	0.031	0.134	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
16	PDB:7ksoA	0.169	0.214	6.923E-3	395	0.051	0.066	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
17	AFDB:E9QG65	0.112	0.099	9.323E-3	632	0.129	0.104	E9QG65.pdb.gz
18	AFDB:D4AA88	0.097	0.078	1.933E-2	684	0.119	0.089	D4AA88.pdb.gz	D4AA88_RAT Tumor protein p73 OS=Rattus norvegicus OX=10116 GN=Tp73 PE=3 SV=1
19	PDB:5v3hA	0.097	0.111	2.333E-2	438	0.023	0.027	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
20	AFDB:A0A0R4IHL8	0.078	0.077	5.769E-2	527	0.094	0.091	A0A0R4IHL8.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AGX3	0.0	854	565	0.822	0.743	PRD11_MOUSE PR domain-containing protein 11 OS=Mus musculus OX=10090 GN=Prdm11 PE=1 SV=1
2	Q9NQV5	0.0	1059	511	1.000	1.000	PRD11_HUMAN PR domain-containing protein 11 OS=Homo sapiens OX=9606 GN=PRDM11 PE=1 SV=2
3	Q96EQ9	2.17e-44	169	843	0.151	0.091	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
4	Q9NQW5	1.00e-41	157	492	0.143	0.148	PRDM7_HUMAN Histone-lysine N-methyltransferase PRDM7 OS=Homo sapiens OX=9606 GN=PRDM7 PE=1 SV=2
5	Q9NQV7	3.60e-41	160	894	0.145	0.083	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
6	Q9VRN4	3.38e-21	100	1203	0.108	0.046	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
7	E9Q8T2	4.24e-20	96.7	1174	0.104	0.045	PRD15_MOUSE PR domain zinc finger protein 15 OS=Mus musculus OX=10090 GN=Prdm15 PE=1 SV=1
8	M9PBR0	1.31e-19	95.1	1216	0.106	0.044	M9PBR0_DROME Blimp-1, isoform B OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=4 SV=1
9	Q9QZP2	8.10e-19	92.4	798	0.110	0.070	PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus OX=10116 GN=Prdm4 PE=2 SV=1
10	Q9UKN5	2.57e-18	90.9	801	0.108	0.069	PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens OX=9606 GN=PRDM4 PE=1 SV=3
11	O75626	2.97e-18	90.5	825	0.110	0.068	PRDM1_HUMAN PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2
12	Q80V63	2.22e-17	87.8	803	0.110	0.070	PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus OX=10090 GN=Prdm4 PE=2 SV=2
13	A0A163UT06	2.92e-17	84.3	277	0.108	0.199	SET17_CAEEL Histone-lysine N-methyltransferase set-17 OS=Caenorhabditis elegans OX=6239 GN=set-17 PE=1 SV=1
14	D4A1S2	7.16e-17	86.3	824	0.110	0.068	D4A1S2_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
15	A0A096MJU6	7.27e-17	86.3	857	0.123	0.074	A0A096MJU6_RAT PR domain zinc finger protein 1 OS=Rattus norvegicus OX=10116 GN=Prdm1 PE=3 SV=1
16	Q60636	1.38e-16	85.5	856	0.110	0.065	PRDM1_MOUSE PR domain zinc finger protein 1 OS=Mus musculus OX=10090 GN=Prdm1 PE=1 SV=1
17	Q9NQV6	2.64e-16	84.7	1147	0.108	0.048	PRD10_HUMAN PR domain zinc finger protein 10 OS=Homo sapiens OX=9606 GN=PRDM10 PE=1 SV=3
18	P57071	8.30e-16	83.2	1507	0.114	0.038	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
19	Q68EH4	1.81e-14	78.6	776	0.088	0.058	Q68EH4_DANRE PR domain zinc finger protein 1 OS=Danio rerio OX=7955 GN=Blimp-1 PE=2 SV=2
20	E9Q3T6	3.10e-14	77.4	561	0.092	0.084	PRD14_MOUSE PR domain zinc finger protein 14 OS=Mus musculus OX=10090 GN=Prdm14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05287 PMG	50	15.4	PMG protein
2	PF00856 SET	0.27	23.1	SET domain
3	PF18445 zf_PR_Knuckle	0.99	20.6	PR zinc knuckle motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000016682

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000022906	0.689	PR domain zinc finger protein 12
2	9593.ENSGGOP00000013231	0.667	PR domain containing 5
3	9593.ENSGGOP00000005565	0.635	PR domain containing 2, with ZNF domain
4	9593.ENSGGOP00000006795	0.582	PR domain containing 13
5	9593.ENSGGOP00000006180	0.526	MAP3K12 binding inhibitory protein 1
6	9593.ENSGGOP00000005595	0.525	Transmembrane protein 196

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0016740	0.430	transferase activity
GO:0008168	0.424	methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.971	regulation of biological process
GO:0050794	0.960	regulation of cellular process
GO:0019222	0.959	regulation of metabolic process
GO:0048522	0.952	positive regulation of cellular process
GO:0080090	0.933	regulation of primary metabolic process
GO:0051171	0.932	regulation of nitrogen compound metabolic process
GO:0060255	0.918	regulation of macromolecule metabolic process
GO:0031323	0.917	regulation of cellular metabolic process
GO:0019219	0.906	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.862	negative regulation of biological process
GO:0010468	0.856	regulation of gene expression
GO:0010556	0.848	regulation of macromolecule biosynthetic process
GO:0006355	0.843	regulation of DNA-templated transcription
GO:0045892	0.834	negative regulation of DNA-templated transcription
GO:0001558	0.515	regulation of cell growth
GO:0010941	0.494	regulation of cell death
GO:0010942	0.464	positive regulation of cell death
GO:0010604	0.438	positive regulation of macromolecule metabolic process
GO:0045935	0.426	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.407	positive regulation of DNA-templated transcription
GO:0009966	0.400	regulation of signal transduction
GO:0030308	0.353	negative regulation of cell growth
GO:1902531	0.343	regulation of intracellular signal transduction
GO:0042981	0.341	regulation of apoptotic process
GO:0051726	0.332	regulation of cell cycle
GO:0043408	0.332	regulation of MAPK cascade
GO:0043065	0.301	positive regulation of apoptotic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.997	cytosol
GO:0031974	0.935	membrane-enclosed lumen
GO:0005654	0.928	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.430	Transferases.
EC:2.1.1.-	0.424	Methyltransferases.

[back to server]