StarFunc result for job id Q9NQV6

User Input

>input (1147 residues)
MDSKDESSHVWPTSAEHEQNAAQVHFVPDTGTVAQIVYTDDQVRPPQQVVYTADGASYTS
VDGPEHTLVYIHPVEAAQTLFTDPGQVAYVQQDATAQQASLPVHNQVLPSIESVDGSDPL
ATLQTPLGRLEAKEEEDEDEDEDTEEDEEEDGEDTDLDDWEPDPPRPFDPHDLWCEECNN
AHASVCPKHGPLHPIPNRPVLTRARASLPLVLYIDRFLGGVFSKRRIPKRTQFGPVEGPL
VRGSELKDCYIHLKVSLDKGDRKERDLHEDLWFELSDETLCNWMMFVRPAQNHLEQNLVA
YQYGHHVYYTTIKNVEPKQELKVWYAASYAEFVNQKIHDISEEERKVLREQEKNWPCYEC
NRRFISSEQLQQHLNSHDEKLDVFSRTRGRGRGRGKRRFGPGRRPGRPPKFIRLEITSEN
GEKSDDGTQDLLHFPTKEQFDEAEPATLNGLDQPEQTTIPIPQLPQETQSSLEHEPETHT
LHLQPQHEESVVPTQSTLTADDMRRAKRIRLELQNAALQHLFIRKSFRPFKCLQCGKAFR
EKDKLDQHLRFHGREGNCPLTCDLCNKGFISSTSLESHMKLHSDQKTYSCIFCPESFDRL
DLLKDHVAIHINDGYFTCPTCKKRFPDFIQVKKHVRSFHSEKIYQCTECDKAFCRPDKLR
LHMLRHSDRKDFLCSTCGKQFKRKDKLREHMQRMHNPEREAKKADRISRSKTFKPRITST
DYDSFTFKCRLCMMGFRRRGMLVNHLSKRHPDMKIEEVPELTLPIIKPNRDYFCQYCDKV
YKSASKRKAHILKNHPGAELPPSIRKLRPAGPGEPDPMLSTHTQLTGTIATPPVCCPHCS
KQYSSKTKMVQHIRKKHPEFAQLSNTIHTPLTTAVISATPAVLTTDSATGETVVTTDLLT
QAMTELSQTLTTDYRTPQGDYQRIQYIPVSQSASGLQQPQHIQLQVVQVASATSPHQSQQ
STVDVGQLHDPQPYPQHAIQVQHIQVSGQPLSPSAQQAQQGLSPSHIQGSSSTQGQALQQ
QQQQQQNSSVQHTYLPSAWNSFRGYSSEIQMMTLPPGQFVITDSGVATPVTTGQVKAVTS
GHYVLSESQSELEEKQTSALSGGVQVEPPAHSDSLDPQTNSQQQTTQYIITTTTNGNGSS
EVHITKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQV6	1.000	1.000	0.000	1147	1.000	1.000	Q9NQV6.pdb.gz	PRD10_HUMAN PR domain zinc finger protein 10 OS=Homo sapiens OX=9606 GN=PRDM10 PE=1 SV=3
2	AFDB:Q80V63	0.093	0.129	3.569E-24	803	0.138	0.197	Q80V63.pdb.gz	PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus OX=10090 GN=Prdm4 PE=2 SV=2
3	AFDB:A2A7B5	0.102	0.070	1.549E-12	1709	0.126	0.085	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
4	AFDB:A2A9J5	0.073	0.117	2.292E-12	645	0.099	0.175	A2A9J5.pdb.gz	A2A9J5_MOUSE Zinc finger protein 980 OS=Mus musculus OX=10090 GN=Zfp980 PE=4 SV=1
5	AFDB:Q13127	0.084	0.086	3.974E-11	1097	0.104	0.108	Q13127.pdb.gz	REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens OX=9606 GN=REST PE=1 SV=3
6	AFDB:Q9VI93	0.075	0.088	5.879E-11	946	0.143	0.173	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
7	AFDB:B2GM62	0.091	0.091	5.510E-10	1142	0.138	0.138	B2GM62.pdb.gz
8	AFDB:A0A0R4IQP3	0.075	0.078	4.366E-9	1093	0.131	0.137	A0A0R4IQP3.pdb.gz
9	AFDB:P47043	0.100	0.122	1.010E-8	880	0.128	0.167	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
10	AFDB:Q92610	0.048	0.045	3.869E-8	1267	0.148	0.134	Q92610.pdb.gz	ZN592_HUMAN Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2
11	PDB:3w5kB	0.054	0.288	2.535E-4	110	0.031	0.318	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5h6zA	0.070	0.499	1.899E-3	123	0.018	0.171	5h6zA.pdb.gz
13	PDB:5hynA	0.086	0.158	3.930E-3	581	0.022	0.043	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
14	PDB:7td5A	0.073	0.157	5.198E-3	497	0.017	0.040	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
15	PDB:5wg6A	0.076	0.160	6.876E-3	517	0.020	0.044	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
16	PDB:7td5F	0.078	0.185	9.619E-3	447	0.019	0.049	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:2g46A	0.073	0.546	1.423E-2	119	0.017	0.168	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
18	PDB:6wkrC	0.072	0.127	3.293E-2	606	0.018	0.035	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
19	PDB:7ksoA	0.076	0.207	3.483E-2	395	0.017	0.051	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
20	PDB:5v3hA	0.055	0.124	4.872E-2	438	0.013	0.034	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQV6	0.0	2391	1147	1.000	1.000	PRD10_HUMAN PR domain zinc finger protein 10 OS=Homo sapiens OX=9606 GN=PRDM10 PE=1 SV=3
2	E9Q8T2	6.82e-44	176	1174	0.170	0.166	PRD15_MOUSE PR domain zinc finger protein 15 OS=Mus musculus OX=10090 GN=Prdm15 PE=1 SV=1
3	Q96EQ9	7.54e-44	174	843	0.161	0.219	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
4	Q8N393	8.79e-31	133	782	0.090	0.132	ZN786_HUMAN Zinc finger protein 786 OS=Homo sapiens OX=9606 GN=ZNF786 PE=1 SV=2
5	Q147U1	7.23e-30	128	533	0.088	0.189	ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens OX=9606 GN=ZNF846 PE=1 SV=2
6	Q7Z398	1.12e-29	125	422	0.064	0.173	ZN550_HUMAN Zinc finger protein 550 OS=Homo sapiens OX=9606 GN=ZNF550 PE=1 SV=2
7	Q9P0L1	1.40e-29	129	754	0.087	0.133	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
8	Q8IYB9	2.88e-29	127	648	0.081	0.144	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
9	Q14C61	4.28e-29	126	627	0.060	0.110	Q14C61_HUMAN ZNF264 protein OS=Homo sapiens OX=9606 GN=ZNF264 PE=1 SV=1
10	Q6NX49	4.29e-29	127	715	0.092	0.147	ZN544_HUMAN Zinc finger protein 544 OS=Homo sapiens OX=9606 GN=ZNF544 PE=1 SV=1
11	Q8N1W2	4.30e-29	127	664	0.078	0.136	ZN710_HUMAN Zinc finger protein 710 OS=Homo sapiens OX=9606 GN=ZNF710 PE=1 SV=2
12	Q02386	4.38e-29	127	682	0.062	0.104	ZNF45_HUMAN Zinc finger protein 45 OS=Homo sapiens OX=9606 GN=ZNF45 PE=1 SV=2
13	O43296	4.56e-29	126	627	0.060	0.110	ZN264_HUMAN Zinc finger protein 264 OS=Homo sapiens OX=9606 GN=ZNF264 PE=1 SV=1
14	A2A761	5.85e-29	125	587	0.068	0.133	ZFP69_MOUSE Zinc finger protein 69 OS=Mus musculus OX=10090 GN=Zfp69 PE=3 SV=1
15	O75467	1.24e-28	124	553	0.065	0.134	Z324A_HUMAN Zinc finger protein 324A OS=Homo sapiens OX=9606 GN=ZNF324 PE=2 SV=1
16	Q08ER8	1.38e-28	125	600	0.058	0.112	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
17	Q9H7X3	1.59e-28	121	374	0.063	0.193	ZN696_HUMAN Zinc finger protein 696 OS=Homo sapiens OX=9606 GN=ZNF696 PE=1 SV=2
18	Q9HCX3	1.59e-28	125	659	0.121	0.211	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
19	Q9BUY5	1.60e-28	124	554	0.084	0.173	ZN426_HUMAN Zinc finger protein 426 OS=Homo sapiens OX=9606 GN=ZNF426 PE=1 SV=1
20	P51523	1.92e-28	125	738	0.095	0.148	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14471 DUF4428	5.7e+02	11.8	Domain of unknown function (DUF4428)
2	PF04780 DUF629	71	13.5	Protein of unknown function (DUF629)
3	PF00856 SET	46	15.8	SET domain
4	PF16638 Tristanin_u2	1.9e-47	172.9	Unstructured region on methyltransferase between zinc-fingers
5	PF00096 zf-C2H2	1.4e-29	112.0	Zinc finger, C2H2 type
6	PF18658 zf-C2H2_12	18	16.5	Spin-doc zinc-finger
7	PF12756 zf-C2H2_2	0.00023	32.8	C2H2 type zinc-finger (2 copies)
8	PF18868 zf-C2H2_3rep	0.1	24.7	Zinc finger C2H2-type, 3 repeats
9	PF13894 zf-C2H2_4	8.5e-23	90.1	C2H2-type zinc finger
10	PF13912 zf-C2H2_6	0.00018	32.7	C2H2-type zinc finger
11	PF12171 zf-C2H2_jaz	5.9e-12	56.8	Zinc-finger double-stranded RNA-binding
12	PF05605 zf-Di19	1.6	20.4	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	9.9e-14	62.3	Zinc-finger double domain
14	PF12874 zf-met	0.0058	28.2	Zinc-finger of C2H2 type
15	PF18445 zf_PR_Knuckle	0.13	23.4	PR zinc knuckle motif
16	PF18439 zf_UBZ	2.8e+02	12.6	Ubiquitin-Binding Zinc Finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000351686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264151	0.717	Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
2	9606.ENSP00000282003	0.669	E3 ubiquitin ligase essential for DNA replication origin activation during S phase . Acts as a replication origin selector which selects the origins to be fired and catalyzes the multi-mono-ubiquitination of a subset of chromatin-bound ORC3 and ORC5 during S-phase
3	9606.ENSP00000382163	0.662	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
4	9606.ENSP00000462269	0.642	Zinc finger protein 488
5	9606.ENSP00000253031	0.619	Protein YIPF2
6	9606.ENSP00000302579	0.604	Sciellin
7	9606.ENSP00000339764	0.604	PR domain zinc finger protein 8
8	9606.ENSP00000385852	0.563	SET domain-containing protein 5
9	9606.ENSP00000455826	0.535	Golgin A8 family member T
10	9606.ENSP00000423159	0.521	Golgin A8 family member O
11	9606.ENSP00000378367	0.509	Pro-neuregulin-4, membrane-bound isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:1901363	0.397	heterocyclic compound binding
GO:0003676	0.380	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0006355	0.986	regulation of DNA-templated transcription
GO:0048522	0.941	positive regulation of cellular process
GO:0009893	0.895	positive regulation of metabolic process
GO:0010604	0.876	positive regulation of macromolecule metabolic process
GO:0031325	0.873	positive regulation of cellular metabolic process
GO:0010557	0.870	positive regulation of macromolecule biosynthetic process
GO:0031328	0.864	positive regulation of cellular biosynthetic process
GO:0045935	0.856	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.839	positive regulation of DNA-templated transcription
GO:0006357	0.816	regulation of transcription by RNA polymerase II
GO:0045944	0.748	positive regulation of transcription by RNA polymerase II
GO:0009987	0.735	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0005634	0.967	nucleus
GO:0043232	0.946	intracellular non-membrane-bounded organelle
GO:0031981	0.946	nuclear lumen
GO:0005694	0.931	chromosome
GO:0032991	0.925	protein-containing complex
GO:0005654	0.901	nucleoplasm
GO:0000785	0.818	chromatin
GO:0005737	0.729	cytoplasm
GO:0017053	0.452	transcription repressor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]