StarFunc result for job id Q9NQV7

User Input

>input (894 residues)
MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNA
LITIGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMALRVEQRKHQKGMP
KASFSNESSLKELSRTANLLNASGSEQAQKPVSPSGEASTSGQHSRLKLELRKKETERKM
YSLRERKGHAYKEVSEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
SLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANNGYSWLITKGRN
CYEYVDGKDKSWANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWYGDE
YGQELGIKWGSKWKKELMAGREPKPEIHPCPSCCLAFSSQKFLSQHVERNHSSQNFPGPS
ARKLLQPENPCPGDQNQEQQYPDPHSRNDKTKGQEIKERSKLLNKRTWQREISRAFSSPP
KGQMGSCRVGKRIMEEESRTGQKVNPGNTGKLFVGVGISRIAKVKYGECGQGFSVKSDVI
THQRTHTGEKLYVCRECGRGFSWKSHLLIHQRIHTGEKPYVCRECGRGFSWQSVLLTHQR
THTGEKPYVCRECGRGFSRQSVLLTHQRRHTGEKPYVCRECGRGFSRQSVLLTHQRRHTG
EKPYVCRECGRGFSWQSVLLTHQRTHTGEKPYVCRECGRGFSWQSVLLTHQRTHTGEKPY
VCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRGFRDKSHLLRHQRTHTGEKPYVCRE
CGRGFRDKSNLLSHQRTHTGEKPYVCRECGRGFSNKSHLLRHQRTHTGEKPYVCRECGRG
FRNKSHLLRHQRTHTGEKPYVCRECGRGFSDRSSLCYHQRTHTGEKPYVCREDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q96EQ9	0.356	0.376	0.000	843	0.685	0.726	Q96EQ9.pdb.gz	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
2	AFDB:Q9NQV7	1.000	1.000	0.000	894	1.000	1.000	Q9NQV7.pdb.gz	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
3	AFDB:Q9NQW5	0.195	0.348	1.655E-54	492	0.412	0.748	Q9NQW5.pdb.gz	PRDM7_HUMAN Histone-lysine N-methyltransferase PRDM7 OS=Homo sapiens OX=9606 GN=PRDM7 PE=1 SV=2
4	AFDB:Q6P1L6	0.367	0.541	2.084E-54	599	0.328	0.489	Q6P1L6.pdb.gz	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
5	AFDB:Q9UJW7	0.262	0.282	7.060E-52	825	0.330	0.358	Q9UJW7.pdb.gz	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
6	AFDB:Q14929	0.306	0.433	2.112E-51	603	0.305	0.453	Q14929.pdb.gz	ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens OX=9606 GN=ZNF169 PE=1 SV=3
7	AFDB:A0A024R4I3	0.339	0.451	9.462E-51	652	0.311	0.426	A0A024R4I3.pdb.gz
8	AFDB:Q14587	0.377	0.357	9.462E-51	947	0.305	0.288	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
9	AFDB:P51814	0.364	0.394	1.423E-49	821	0.264	0.287	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
10	AFDB:Q6ZNH5	0.318	0.523	1.692E-49	498	0.229	0.412	Q6ZNH5.pdb.gz	ZN497_HUMAN Zinc finger protein 497 OS=Homo sapiens OX=9606 GN=ZNF497 PE=1 SV=2
11	PDB:5h6zA	0.098	0.589	3.360E-5	123	0.027	0.195	5h6zA.pdb.gz
12	PDB:5hynA	0.105	0.158	3.995E-5	581	0.030	0.046	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
13	PDB:5wg6A	0.104	0.175	7.534E-5	517	0.039	0.068	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
14	PDB:7ksoA	0.106	0.229	1.341E-4	395	0.031	0.071	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
15	PDB:3w5kB	0.064	0.285	1.595E-4	110	0.047	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
16	PDB:7td5F	0.107	0.203	1.595E-4	447	0.032	0.065	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
17	PDB:1pegA	0.104	0.327	2.839E-4	266	0.029	0.098	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:6wkrC	0.108	0.155	3.007E-4	606	0.034	0.050	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
19	PDB:7td5A	0.108	0.187	5.054E-4	497	0.032	0.058	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
20	PDB:2g46A	0.099	0.597	1.347E-3	119	0.022	0.168	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P52736	0.0	570	654	0.328	0.448	ZN133_HUMAN Zinc finger protein 133 OS=Homo sapiens OX=9606 GN=ZNF133 PE=1 SV=2
2	Q6P1L6	0.0	563	599	0.332	0.496	ZN343_HUMAN Zinc finger protein 343 OS=Homo sapiens OX=9606 GN=ZNF343 PE=1 SV=1
3	Q96EQ9	0.0	1258	843	0.696	0.738	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
4	Q9NQV7	0.0	1855	894	1.000	1.000	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
5	Q9NQW5	0.0	733	492	0.388	0.705	PRDM7_HUMAN Histone-lysine N-methyltransferase PRDM7 OS=Homo sapiens OX=9606 GN=PRDM7 PE=1 SV=2
6	O94892	5.30e-172	515	652	0.258	0.354	ZN432_HUMAN Zinc finger protein 432 OS=Homo sapiens OX=9606 GN=ZNF432 PE=1 SV=1
7	Q14929	2.04e-169	507	603	0.306	0.454	ZN169_HUMAN Zinc finger protein 169 OS=Homo sapiens OX=9606 GN=ZNF169 PE=1 SV=3
8	Q9Y3M9	7.01e-167	506	751	0.286	0.341	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
9	P51523	2.24e-159	486	738	0.258	0.313	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
10	Q5MCW4	5.45e-153	468	686	0.239	0.312	ZN569_HUMAN Zinc finger protein 569 OS=Homo sapiens OX=9606 GN=ZNF569 PE=1 SV=1
11	Q14585	2.00e-152	459	488	0.245	0.449	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
12	Q8TAQ5	4.46e-152	465	688	0.261	0.339	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
13	Q8N184	1.86e-151	462	647	0.237	0.328	ZN567_HUMAN Zinc finger protein 567 OS=Homo sapiens OX=9606 GN=ZNF567 PE=1 SV=3
14	Q7TMN8	4.08e-151	459	578	0.261	0.403	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
15	Q8BLA2	4.69e-151	459	578	0.261	0.403	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
16	P17027	7.53e-151	461	643	0.239	0.333	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
17	P51814	1.16e-150	466	821	0.240	0.262	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
18	A0A0A0MS50	2.78e-150	457	604	0.238	0.353	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
19	Q96RE9	2.78e-150	457	604	0.238	0.353	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
20	Q14587	1.10e-149	467	947	0.243	0.229	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11672 DUF3268	0.076	24.7	zinc-finger-containing domain
2	PF12773 DZR	3.1	19.2	Double zinc ribbon
3	PF12833 HTH_18	3.7	19.2	Helix-turn-helix domain
4	PF01352 KRAB	0.006	27.5	KRAB box
5	PF02305 Phage_F	76	13.5	Capsid protein (F protein)
6	PF00628 PHD	5.2e+02	12.0	PHD-finger
7	PF00856 SET	0.0072	28.2	SET domain
8	PF09514 SSXRD	2.1e-12	57.7	SSXRD motif
9	PF00096 zf-C2H2	5.1e-61	211.0	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	0.0016	29.4	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	1.6e-40	145.2	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	8.2e-05	33.8	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	3.5e-19	79.8	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	3.9e-80	272.2	Zinc-finger double domain
15	PF13451 zf-trcl	3.1e-06	38.3	Probable zinc-ribbon domain
16	PF18445 zf_PR_Knuckle	13	17.0	PR zinc knuckle motif
17	PF18439 zf_UBZ	2.1	19.4	Ubiquitin-Binding Zinc Finger
18	PF17032 zinc_ribbon_15	0.00042	32.3	zinc-ribbon family
19	PF09723 Zn-ribbon_8	2e-06	39.1	Zinc ribbon domain
20	PF17283 Zn_ribbon_SprT	0.099	24.0	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296682

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360310	0.958	Meiotic recombination protein SPO11
2	9606.ENSP00000434024	0.948	Histone H2AX
3	9606.ENSP00000296417	0.918	Histone H2A.Z
4	9606.ENSP00000332194	0.918	Histone H2A type 2-C
5	9606.ENSP00000358151	0.914	Histone H2B type 2-E
6	9606.ENSP00000390475	0.914	CXXC-type zinc finger protein 1
7	9606.ENSP00000274764	0.912	Histone H2B type 1-A
8	9606.ENSP00000482674	0.907	Histone H2B type 1-B
9	9606.ENSP00000308405	0.903	Histone H2A.V
10	9606.ENSP00000328484	0.903	Histone H2A type 1-J
11	9606.ENSP00000341094	0.903	Histone H2A type 1-D
12	9606.ENSP00000367022	0.903	Histone H2A type 1-C
13	9606.ENSP00000438553	0.903	Histone H2A.J
14	9606.ENSP00000484261	0.903	Histone H2A-Bbd type 1
15	9606.ENSP00000289316	0.901	Histone H2B type 1-D
16	9606.ENSP00000349430	0.901	Histone H2B type 1-K
17	9606.ENSP00000366618	0.901	Histone H2B type 1-L
18	9606.ENSP00000476136	0.901	Histone H2B type 1-J
19	9606.ENSP00000477527	0.901	Histone H2B type 1-O
20	9606.ENSP00000477907	0.901	Histone H2B type 1-M

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042800	0.998	histone H3K4 methyltransferase activity
GO:0043565	0.997	sequence-specific DNA binding
GO:0046975	0.995	histone H3K36 methyltransferase activity
GO:0003690	0.975	double-stranded DNA binding
GO:1990837	0.970	sequence-specific double-stranded DNA binding
GO:0001067	0.958	transcription regulatory region nucleic acid binding
GO:0000976	0.936	transcription cis-regulatory region binding
GO:0042802	0.356	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0044238	0.980	primary metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:0006807	0.977	nitrogen compound metabolic process
GO:0019222	0.976	regulation of metabolic process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0080090	0.972	regulation of primary metabolic process
GO:0051171	0.972	regulation of nitrogen compound metabolic process
GO:0044237	0.971	cellular metabolic process
GO:0048518	0.969	positive regulation of biological process
GO:0031323	0.968	regulation of cellular metabolic process
GO:0044260	0.963	cellular macromolecule metabolic process
GO:0019219	0.959	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.927	positive regulation of cellular process
GO:0006310	0.897	DNA recombination
GO:0051052	0.896	regulation of DNA metabolic process
GO:0010564	0.866	regulation of cell cycle process
GO:0045787	0.856	positive regulation of cell cycle
GO:0010468	0.834	regulation of gene expression
GO:0051321	0.832	meiotic cell cycle
GO:0009893	0.829	positive regulation of metabolic process
GO:0051173	0.819	positive regulation of nitrogen compound metabolic process
GO:0031325	0.816	positive regulation of cellular metabolic process
GO:1903046	0.810	meiotic cell cycle process
GO:0040020	0.788	regulation of meiotic nuclear division
GO:0010604	0.769	positive regulation of macromolecule metabolic process
GO:0045935	0.769	positive regulation of nucleobase-containing compound metabolic process
GO:0061982	0.716	meiosis I cell cycle process
GO:0035825	0.648	homologous recombination
GO:0009889	0.630	regulation of biosynthetic process
GO:0031326	0.610	regulation of cellular biosynthetic process
GO:0051252	0.595	regulation of RNA metabolic process
GO:0010556	0.518	regulation of macromolecule biosynthetic process
GO:0051054	0.518	positive regulation of DNA metabolic process
GO:0048519	0.515	negative regulation of biological process
GO:0071840	0.492	cellular component organization or biogenesis
GO:0050896	0.454	response to stimulus
GO:0048523	0.447	negative regulation of cellular process
GO:0000018	0.421	regulation of DNA recombination
GO:0016043	0.420	cellular component organization
GO:0051785	0.418	positive regulation of nuclear division
GO:0051446	0.392	positive regulation of meiotic cell cycle
GO:0090068	0.390	positive regulation of cell cycle process
GO:0045911	0.380	positive regulation of DNA recombination
GO:2001141	0.338	regulation of RNA biosynthetic process
GO:0006355	0.331	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043228	0.325	non-membrane-bounded organelle
GO:0043232	0.324	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:60260	0.998	L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine
EC:2.1.1.354	0.998	[histone H3]-lysine(4) N-trimethyltransferase.

[back to server]