StarFunc result for job id Q9NQV8

User Input

>input (689 residues)
MEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCDIPENAIFGPCVLSHTSLYDSIAFIAL
KSTDKRTVPYIFRVDTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRI
AKDEELLVWYGKELTELLLLCPSRSHNKMNGSSPYTCLECSQRFQFEFPYVAHLRFRCPK
RLHSADISPQDEQGGGVGTKDHGGGGGGGKDQQQQQQEAPLGPGPKFCKAGPLHHYPSPS
PESSNPSAAAGGSSAKPSTDFHNLARELENSRGGSSCSPAQSLSSGSGSGGGGGHQEAEL
SPDGIATGGGKGKRKFPEEAAEGGGGAGLVGGRGRFVERPLPASKEDLVCTPQQYRASGS
YFGLEENGRLFAPPSPETGEAKRSAFVEVKKAARAASLQEEGTADGAGVASEDQDAGGGG
GSSTPAAASPVGAEKLLAPRPGGPLPSRLEGGSPARGSAFTSVPQLGSAGSTSGGGGTGA
GAAGGAGGGQGAASDERKSAFSQPARSFSQLSPLVLGQKLGALEPCHPADGVGPTRLYPA
AADPLAVKLQGAADLNGGCGSLPSGGGGLPKQSPFLYATAFWPKSSAAAAAAAAAAAAGP
LQLQLPSALTLLPPSFTSLCLPAQNWCAKCNASFRMTSDLVYHMRSHHKKEYAMEPLVKR
RREEKLKCPICNESFRERHHLSRHMTSHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RDC4	0.386	0.386	1.523E-96	689	1.000	1.000	A0A024RDC4.pdb.gz
2	AFDB:Q8BZ97	0.360	0.361	4.031E-82	687	0.842	0.844	Q8BZ97.pdb.gz	PRDM8_MOUSE PR domain zinc finger protein 8 OS=Mus musculus OX=10090 GN=Prdm8 PE=1 SV=2
3	AFDB:Q5BIH1	0.067	0.059	4.385E-4	803	0.138	0.118	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
4	AFDB:P33749	0.062	0.066	4.830E-3	630	0.119	0.130	P33749.pdb.gz	MSN4_YEAST Zinc finger protein MSN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSN4 PE=1 SV=1
5	AFDB:Q4WPF5	0.057	0.063	1.707E-2	618	0.132	0.147	Q4WPF5.pdb.gz	SEBA_ASPFU C2H2 finger domain transcription factor sebA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=sebA PE=4 SV=1
6	AFDB:M9NEG1	0.047	0.031	2.656E-2	1109	0.145	0.090	M9NEG1.pdb.gz	M9NEG1_DROME Maternal gene required for meiosis, isoform F OS=Drosophila melanogaster OX=7227 GN=mamo PE=4 SV=1
7	PDB:2g46A	0.065	0.296	3.771E-2	119	0.017	0.101	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
8	PDB:5h6zA	0.072	0.321	4.017E-2	123	0.026	0.146	5h6zA.pdb.gz
9	AFDB:A0A024RC04	0.045	0.041	1.000E-1	805	0.112	0.096	A0A024RC04.pdb.gz
10	PDB:3qxyA	0.044	0.071	1.175E-1	420	0.010	0.017	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
11	AFDB:A0A0R4IKC9	0.053	0.031	1.288E-1	1268	0.134	0.073	A0A0R4IKC9.pdb.gz	A0A0R4IKC9_DANRE Basonuclin 2 OS=Danio rerio OX=7955 GN=bnp PE=4 SV=1
12	AFDB:A2A884	0.062	0.021	1.288E-1	2348	0.168	0.049	A2A884.pdb.gz	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
13	AFDB:Q96S38	0.045	0.035	1.461E-1	1066	0.122	0.079	Q96S38.pdb.gz	KS6C1_HUMAN Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1 PE=1 SV=2
14	PDB:5ex0A	0.058	0.091	2.506E-1	429	0.017	0.028	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
15	PDB:3n71A	0.052	0.075	5.019E-1	468	0.025	0.036	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
16	PDB:5v3hA	0.057	0.088	7.331E-1	438	0.015	0.023	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
17	PDB:7td5A	0.054	0.074	8.318E-1	497	0.016	0.022	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
18	PDB:6kreb	0.053	0.072	9.437E-1	444	0.026	0.041	6kreb.pdb.gz
19	PDB:5wg6A	0.049	0.064	1.215	517	0.016	0.021	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
20	PDB:6wkrC	0.063	0.070	1.215	606	0.015	0.017	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PEH0	0.0	872	427	0.620	1.000	E9PEH0_HUMAN PR/SET domain 8 (Fragment) OS=Homo sapiens OX=9606 GN=PRDM8 PE=1 SV=8
2	Q8BZ97	0.0	1063	688	0.866	0.868	PRDM8_MOUSE PR domain zinc finger protein 8 OS=Mus musculus OX=10090 GN=Prdm8 PE=1 SV=2
3	Q9NQV8	0.0	1393	689	1.000	1.000	PRDM8_HUMAN PR domain zinc finger protein 8 OS=Homo sapiens OX=9606 GN=PRDM8 PE=1 SV=3
4	Q96MN9	8.61e-36	140	340	0.149	0.303	ZN488_HUMAN Zinc finger protein 488 OS=Homo sapiens OX=9606 GN=ZNF488 PE=1 SV=1
5	Q5HZG9	3.26e-30	124	337	0.077	0.157	ZN488_MOUSE Zinc finger protein 488 OS=Mus musculus OX=10090 GN=Znf488 PE=1 SV=2
6	E9PZZ1	1.43e-12	73.6	754	0.052	0.048	PRD13_MOUSE PR domain zinc finger protein 13 OS=Mus musculus OX=10090 GN=Prdm13 PE=2 SV=1
7	A0A163UT06	1.39e-10	65.1	277	0.064	0.159	SET17_CAEEL Histone-lysine N-methyltransferase set-17 OS=Caenorhabditis elegans OX=6239 GN=set-17 PE=1 SV=1
8	F1R7D7	2.73e-10	65.9	614	0.049	0.055	F1R7D7_DANRE PR domain zinc finger protein 13 OS=Danio rerio OX=7955 GN=prdm13 PE=4 SV=2
9	Q9NQV7	2.40e-08	60.1	894	0.055	0.043	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
10	Q96EQ9	1.24e-07	57.4	843	0.054	0.044	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
11	Q9GZV8	2.23e-07	56.6	571	0.046	0.056	PRD14_HUMAN PR domain zinc finger protein 14 OS=Homo sapiens OX=9606 GN=PRDM14 PE=1 SV=1
12	Q9NQW5	4.57e-07	55.5	492	0.055	0.077	PRDM7_HUMAN Histone-lysine N-methyltransferase PRDM7 OS=Homo sapiens OX=9606 GN=PRDM7 PE=1 SV=2
13	Q7T0V8	7.56e-07	54.3	355	0.039	0.076	Q7T0V8_XENLA PR domain zinc finger protein 12 OS=Xenopus laevis OX=8355 GN=prdm12.L PE=2 SV=1
14	E9Q3T6	8.04e-07	54.7	561	0.045	0.055	PRD14_MOUSE PR domain zinc finger protein 14 OS=Mus musculus OX=10090 GN=Prdm14 PE=1 SV=1
15	Q5U3V3	8.59e-07	53.9	366	0.057	0.107	Q5U3V3_DANRE PR domain zinc finger protein 12 OS=Danio rerio OX=7955 GN=prdm12b PE=2 SV=1
16	F1QWQ9	8.68e-07	54.7	568	0.045	0.055	F1QWQ9_DANRE PR domain zinc finger protein 14 isoform X1 OS=Danio rerio OX=7955 GN=fc16b12 PE=4 SV=1
17	Q6XSK8	1.32e-06	53.9	517	0.045	0.060	Q6XSK8_DANRE PR domain zinc finger protein 14 OS=Danio rerio OX=7955 GN=wu:fc16b12 PE=4 SV=2
18	Q9H4Q4	3.29e-06	52.4	367	0.038	0.071	PRD12_HUMAN PR domain zinc finger protein 12 OS=Homo sapiens OX=9606 GN=PRDM12 PE=1 SV=2
19	A2AJ77	3.83e-06	52.0	365	0.038	0.071	PRD12_MOUSE PR domain zinc finger protein 12 OS=Mus musculus OX=10090 GN=Prdm12 PE=2 SV=1
20	Q9VRN4	1.31e-05	51.2	1203	0.052	0.030	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19126 DUF5810	5.5e+02	12.1	Family of unknown function (DUF5810)
2	PF00856 SET	20	17.0	SET domain
3	PF00096 zf-C2H2	0.012	27.1	Zinc finger, C2H2 type
4	PF12756 zf-C2H2_2	1.7e+02	14.0	C2H2 type zinc-finger (2 copies)
5	PF13894 zf-C2H2_4	0.0047	28.6	C2H2-type zinc finger
6	PF05605 zf-Di19	2.6e+02	13.3	Drought induced 19 protein (Di19), zinc-binding
7	PF13465 zf-H2C2_2	14	17.5	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339764

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000318799	0.963	Class E basic helix-loop-helix protein 22
2	9606.ENSP00000384725	0.828	Putative histone-lysine N-methyltransferase PRDM6
3	9606.ENSP00000269844	0.785	PR domain zinc finger protein 15
4	9606.ENSP00000235372	0.758	PR domain zinc finger protein 2
5	9606.ENSP00000345464	0.647	E3 ubiquitin-protein ligase NHLRC1
6	9606.ENSP00000356489	0.641	Laforin
7	9606.ENSP00000264808	0.629	PR domain zinc finger protein 5
8	9606.ENSP00000351686	0.604	PR domain zinc finger protein 10
9	9606.ENSP00000480998	0.590	Class E basic helix-loop-helix protein 23
10	9606.ENSP00000296575	0.565	Hedgehog-interacting protein
11	9606.ENSP00000265838	0.560	Acetyl-CoA acetyltransferase, mitochondrial
12	9606.ENSP00000480626	0.543	PR domain-containing protein 11
13	9606.ENSP00000270722	0.531	PR domain zinc finger protein 16
14	9606.ENSP00000264674	0.520	MDS1 and EVI1 complex locus protein EVI1
15	9606.ENSP00000280097	0.500	Histamine N-methyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008276	0.996	protein methyltransferase activity
GO:0140110	0.993	transcription regulator activity
GO:0003682	0.988	chromatin binding
GO:0008757	0.963	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	0.963	N-methyltransferase activity
GO:0042054	0.946	histone methyltransferase activity
GO:0018024	0.939	histone lysine N-methyltransferase activity
GO:0140938	0.921	histone H3 methyltransferase activity
GO:0003714	0.898	transcription corepressor activity
GO:0046974	0.880	histone H3K9 methyltransferase activity
GO:0003677	0.473	DNA binding
GO:0003690	0.407	double-stranded DNA binding
GO:0043565	0.400	sequence-specific DNA binding
GO:0003700	0.398	DNA-binding transcription factor activity
GO:0000981	0.376	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:1990837	0.375	sequence-specific double-stranded DNA binding
GO:0000976	0.320	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.971	regulation of cellular metabolic process
GO:0009987	0.970	cellular process
GO:0051171	0.970	regulation of nitrogen compound metabolic process
GO:0010468	0.964	regulation of gene expression
GO:0019219	0.960	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.951	regulation of biosynthetic process
GO:0048519	0.949	negative regulation of biological process
GO:0032502	0.948	developmental process
GO:0032501	0.944	multicellular organismal process
GO:0006355	0.942	regulation of DNA-templated transcription
GO:0048523	0.940	negative regulation of cellular process
GO:0048468	0.935	cell development
GO:0045892	0.924	negative regulation of DNA-templated transcription
GO:0007275	0.919	multicellular organism development
GO:0071840	0.906	cellular component organization or biogenesis
GO:0016043	0.902	cellular component organization
GO:0048513	0.900	animal organ development
GO:0009653	0.857	anatomical structure morphogenesis
GO:0048731	0.857	system development
GO:0007399	0.832	nervous system development
GO:0048666	0.768	neuron development
GO:0030030	0.589	cell projection organization
GO:0000902	0.533	cell morphogenesis
GO:0007420	0.523	brain development
GO:0030900	0.501	forebrain development
GO:0031175	0.464	neuron projection development
GO:0048858	0.436	cell projection morphogenesis
GO:0021953	0.323	central nervous system neuron differentiation
GO:0021954	0.314	central nervous system neuron development
GO:0006357	0.310	regulation of transcription by RNA polymerase II
GO:0000904	0.300	cell morphogenesis involved in differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016604	0.941	nuclear body
GO:0005737	0.691	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.996	Methyltransferases.
RHEA:51736	0.939	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]