StarFunc result for job id Q9NQW1

User Input

>input (1179 residues)
MKLKELERPAVQAWSPASQYPLYLATGTSAQQLDSSFSTNGTLEIFEVDFRDPSLDLKHR
GVLSALSRFHKLVWGSFGSGLLESSGVIVGGGDNGMLILYNVTHILSSGKEPVIAQKQKH
TGAVRALDLNPFQGNLLASGASDSEIFIWDLNNLNVPMTLGSKSQQPPEDIKALSWNRQA
QHILSSAHPSGKAVVWDLRKNEPIIKVSDHSNRMHCSGLAWHPDIATQLVLCSEDDRLPV
IQLWDLRFASSPLKVLESHSRGILSVSWSQADAELLLTSAKDSQILCRNLGSSEVVYKLP
TQSSWCFDVQWCPRDPSVFSAASFNGWISLYSVMGRSWEVQHMRQADKISSSFSKGQPLP
PLQVPEQVAQAPLIPPLKKPPKWIRRPTGVSFAFGGKLVTFGLPSTPAHLVPQPCPRLVF
ISQVTTESEFLMRSAELQEALGSGNLLNYCQNKSQQALLQSEKMLWQFLKVTLEQDSRMK
FLKLLGYSKDELQKKVATWLKSDVGLGESPQPKGNDLNSDRQQAFCSQASKHTTKEASAS
SAFFDELVPQNMTPWEIPITKDIDGLLSQALLLGELGPAVELCLKEERFADAIILAQAGG
TDLLKQTQERYLAKKKTKISSLLACVVQKNWKDVVCTCSLKNWREALALLLTYSGTEKFP
ELCDMLGTRMEQEGSRALTSEARLCYVCSGSVERLVECWAKCHQALSPMALQDLMEKVMV
LNRSLEQLRGPHGVSPGPATTYRVTQYANLLAAQGSLATAMSFLPRDCAQPPVQQLRDRL
FHAQGSAVLGQQSPPFPFPRIVVGATLHSKETSSYRLGSQPSHQVPTPSPRPRVFTPQSS
PAMPLAPSHPSPYQGPRTQNISDYRAPGPQAIQPLPLSPGVRPASSQPQLLGGQRVQVPN
PVGFPGTWPLPGSPLPMACPGIMRPGSTSLPETPRLFPLLPLRPLGPGRMVSHTPAPPAS
FPVPYLPGDPGAPCSSVLPTTGILTPHPGPQDSWKEAPAPRGNLQRNKLPETFMPPAPIT
APVMSLTPELQGILPSQPPVSSVSHAPPGVPGELSLQLQHLPPEKMERKELPPEHQSLKS
SFEALLQRCSLSATDLKTKRKLEEAAQRLEYLYEKLCEGTLSPHVVAGLHEVARCVDAGS
FEQGLAVHAQVAGCSSFSEVSSFMPILKAVLIIAHKLLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQW1	1.000	1.000	0.000	1179	1.000	1.000	Q9NQW1.pdb.gz	SC31B_HUMAN Protein transport protein Sec31B OS=Homo sapiens OX=9606 GN=SEC31B PE=1 SV=1
2	AFDB:D6REX3	0.631	0.597	2.527E-101	1251	0.501	0.472	D6REX3.pdb.gz	D6REX3_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
3	AFDB:Q3UPL0	0.716	0.687	4.737E-101	1230	0.499	0.478	Q3UPL0.pdb.gz	SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus OX=10090 GN=Sec31a PE=1 SV=2
4	AFDB:A0A024RDH6	0.604	0.603	3.639E-98	1181	0.485	0.484	A0A024RDH6.pdb.gz
5	AFDB:Q7SYD5	0.682	0.643	3.303E-94	1254	0.464	0.436	Q7SYD5.pdb.gz	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
6	AFDB:A0A0B4LEZ1	0.582	0.545	2.357E-75	1260	0.343	0.321	A0A0B4LEZ1.pdb.gz	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
7	AFDB:A1Z7J7	0.582	0.554	2.662E-74	1240	0.339	0.323	A1Z7J7.pdb.gz	A1Z7J7_DROME Secretory 31, isoform A OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
8	AFDB:Q8L611	0.504	0.536	1.230E-63	1104	0.283	0.303	Q8L611.pdb.gz	SC31B_ARATH Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana OX=3702 GN=SEC31B PE=1 SV=1
9	AFDB:O13637	0.531	0.512	8.908E-53	1224	0.234	0.225	O13637.pdb.gz	SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec31 PE=1 SV=1
10	AFDB:P38968	0.499	0.466	1.234E-46	1273	0.239	0.222	P38968.pdb.gz	SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC31 PE=1 SV=3
11	PDB:4bzjC	0.479	0.783	3.046E-33	693	0.155	0.264	4bzjC.pdb.gz
12	PDB:7uhyC	0.234	0.458	1.489E-16	578	0.068	0.138	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
13	PDB:6zrdA	0.243	0.657	1.759E-15	411	0.056	0.161	6zrdA.pdb.gz	Structure Based Design of Bicyclic Peptide Inhibitors of RbAp48.
14	PDB:7mq8LU	0.238	0.607	2.520E-15	445	0.047	0.126	7mq8LU.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:3cfvB	0.243	0.691	2.756E-15	393	0.054	0.163	3cfvB.pdb.gz	Structural Basis for the Recognition of Histone H4 by the Histone-Chaperone RbAp46.
16	PDB:6nd4U	0.232	0.640	2.756E-15	407	0.060	0.174	6nd4U.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
17	PDB:2ybaB	0.242	0.706	3.298E-15	382	0.061	0.188	2ybaB.pdb.gz	Histone Methylation by Prc2 is Inhibited by Active Chromatin Marks
18	PDB:3gfcA	0.236	0.772	3.608E-15	339	0.055	0.192	3gfcA.pdb.gz
19	PDB:6s29C	0.230	0.659	4.941E-15	394	0.057	0.170	6s29C.pdb.gz
20	PDB:7uhyA	0.222	0.329	5.405E-15	771	0.092	0.140	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D6REX3	0.0	1057	1251	0.502	0.473	D6REX3_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
2	D6RHZ5	0.0	919	877	0.382	0.513	D6RHZ5_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
3	Q3UPL0	0.0	1051	1230	0.510	0.489	SC31A_MOUSE Protein transport protein Sec31A OS=Mus musculus OX=10090 GN=Sec31a PE=1 SV=2
4	Q7SYD5	0.0	846	1254	0.356	0.335	SC31A_DANRE Protein transport protein Sec31A OS=Danio rerio OX=7955 GN=sec31a PE=2 SV=1
5	Q9NQW1	0.0	2394	1179	1.000	1.000	SC31B_HUMAN Protein transport protein Sec31B OS=Homo sapiens OX=9606 GN=SEC31B PE=1 SV=1
6	H7BXG7	3.96e-165	517	969	0.230	0.280	H7BXG7_HUMAN SEC31 homolog A, COPII coat complex component OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
7	H0YAB3	2.28e-136	423	443	0.182	0.483	H0YAB3_HUMAN SEC31 homolog A, COPII coat complex component (Fragment) OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=1
8	Q8L611	2.02e-120	401	1104	0.275	0.293	SC31B_ARATH Protein transport protein SEC31 homolog B OS=Arabidopsis thaliana OX=3702 GN=SEC31B PE=1 SV=1
9	O13637	4.02e-74	271	1224	0.181	0.174	SEC31_SCHPO Protein transport protein sec31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec31 PE=1 SV=1
10	P38968	9.78e-61	230	1273	0.173	0.160	SEC31_YEAST Protein transport protein SEC31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC31 PE=1 SV=3
11	O94979	5.48e-41	167	1220	0.092	0.089	SC31A_HUMAN Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3
12	Q9Z2Q1	2.20e-39	162	1249	0.091	0.086	SC31A_RAT Protein transport protein Sec31A OS=Rattus norvegicus OX=10116 GN=Sec31a PE=1 SV=2
13	O96221	1.94e-37	155	1471	0.089	0.071	O96221_PLAF7 Protein transport protein SEC31 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0214100 PE=3 SV=3
14	Q385F2	5.29e-28	125	1231	0.081	0.077	Q385F2_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.4040 PE=3 SV=1
15	Q961K5	7.93e-11	68.9	777	0.027	0.041	Q961K5_DROME GH19061p OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=2 SV=1
16	Q5U0U9	1.71e-10	68.2	1240	0.027	0.026	Q5U0U9_DROME AT25839p OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=2 SV=1
17	A1Z7J6	1.74e-10	68.2	1241	0.027	0.026	A1Z7J6_DROME Secretory 31, isoform B OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
18	A1Z7J7	1.76e-10	68.2	1240	0.027	0.026	A1Z7J7_DROME Secretory 31, isoform A OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
19	A0A0B4LEY1	1.86e-10	68.2	1259	0.027	0.025	A0A0B4LEY1_DROME Secretory 31, isoform C OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1
20	A0A0B4LEZ1	1.86e-10	68.2	1260	0.027	0.025	A0A0B4LEZ1_DROME Secretory 31, isoform D OS=Drosophila melanogaster OX=7227 GN=Sec31 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	0.2	23.3	Anaphase-promoting complex subunit 4 WD40 domain
2	PF12931 Sec16_C	0.12	23.6	Sec23-binding domain of Sec16
3	PF00400 WD40	6	19.1	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359370

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000373312	0.995	Protein SEC13 homolog
2	9606.ENSP00000338844	0.983	Protein transport protein Sec23B
3	9606.ENSP00000428564	0.978	Protein transport protein Sec24B
4	9606.ENSP00000381823	0.975	Protein transport protein Sec24A
5	9606.ENSP00000362339	0.974	GTP-binding protein SAR1a
6	9606.ENSP00000385432	0.973	GTP-binding protein SAR1b
7	9606.ENSP00000306881	0.970	Protein transport protein Sec23A
8	9606.ENSP00000325827	0.966	Protein transport protein Sec16A
9	9606.ENSP00000280551	0.957	Protein transport protein Sec24D
10	9606.ENSP00000343405	0.954	Protein transport protein Sec24C
11	9606.ENSP00000308339	0.874	Protein transport protein Sec16B
12	9606.ENSP00000378721	0.810	Protein transport protein Sec31A
13	9606.ENSP00000264933	0.782	Programmed cell death protein 6
14	9606.ENSP00000356230	0.736	Kelch-like protein 12
15	9606.ENSP00000362807	0.727	Peflin
16	9606.ENSP00000357048	0.685	Coatomer subunit alpha
17	9606.ENSP00000260643	0.671	Prolactin regulatory element-binding protein
18	9606.ENSP00000258091	0.658	T-complex protein 1 subunit eta
19	9606.ENSP00000329419	0.653	Coatomer subunit beta
20	9606.ENSP00000221494	0.602	Splicing factor 3A subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051641	0.988	cellular localization
GO:0051234	0.979	establishment of localization
GO:0006996	0.969	organelle organization
GO:0051649	0.945	establishment of localization in cell
GO:0006810	0.830	transport
GO:0046907	0.766	intracellular transport
GO:0065007	0.757	biological regulation
GO:0050789	0.575	regulation of biological process
GO:0050794	0.472	regulation of cellular process
GO:0016192	0.465	vesicle-mediated transport
GO:0048193	0.438	Golgi vesicle transport
GO:0006888	0.320	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0048518	0.318	positive regulation of biological process
GO:0050896	0.304	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031090	0.995	organelle membrane
GO:0032991	0.992	protein-containing complex
GO:0030135	0.977	coated vesicle
GO:0012505	0.971	endomembrane system
GO:0030662	0.948	coated vesicle membrane
GO:0030117	0.945	membrane coat
GO:0030120	0.920	vesicle coat
GO:0005829	0.904	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]