StarFunc result for job id Q9NQW5

User Input

>input (492 residues)
MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNA
LITVGLRATRPAFMCHRRQAIKLQVDDTEDSDEEWTPRQQVKPPWMAFRGEQSKHQKGMP
KASFNNESSLRELSGTPNLLNTSDSEQAQKPVSPPGEASTSGQHSRLKLELRRKETEGKM
YSLRERKGHAYKEISEPQDDDYLYCEMCQNFFIDSCAAHGPPTFVKDSAVDKGHPNRSAL
SLPPGLRIGPSGIPQAGLGVWNEASDLPLGLHFGPYEGRITEDEEAANSGYSWLITKGRN
CYEYVDGKDKSSANWMRYVNCARDDEEQNLVAFQYHRQIFYRTCRVIRPGCELLVWSGDE
YGQELGIRSSIEPAESLGQAVNCWSGMGMSMARNWASSGAASGRKSSWQGENQSQRSIHV
PHAVWPFQVKNFSVNMWNAITPLRTSQDHLQENFSNQRIPAQGIRIRSGNILIHAAVMTK
PKVKRSKKGPNS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQW5	1.000	1.000	2.928E-87	492	1.000	1.000	Q9NQW5.pdb.gz	PRDM7_HUMAN Histone-lysine N-methyltransferase PRDM7 OS=Homo sapiens OX=9606 GN=PRDM7 PE=1 SV=2
2	AFDB:Q9NQV7	0.347	0.195	8.955E-57	894	0.742	0.408	Q9NQV7.pdb.gz	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
3	AFDB:Q96EQ9	0.377	0.225	7.283E-52	843	0.585	0.342	Q96EQ9.pdb.gz	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
4	PDB:1pegA	0.196	0.341	1.522E-5	266	0.071	0.132	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
5	PDB:5wg6A	0.183	0.175	1.522E-5	517	0.057	0.054	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
6	PDB:5hynA	0.186	0.159	2.188E-5	581	0.055	0.046	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
7	PDB:6wkrC	0.185	0.152	4.802E-5	606	0.055	0.045	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
8	AFDB:Q2LAE1	0.191	0.060	6.884E-5	1759	0.138	0.039	Q2LAE1.pdb.gz	ASHH2_ARATH Histone-lysine N-methyltransferase ASHH2 OS=Arabidopsis thaliana OX=3702 GN=ASHH2 PE=1 SV=1
9	PDB:5h6zA	0.180	0.635	1.119E-4	123	0.045	0.179	5h6zA.pdb.gz
10	PDB:7td5F	0.187	0.205	1.119E-4	447	0.053	0.058	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
11	PDB:7td5A	0.187	0.185	2.049E-4	497	0.055	0.054	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
12	PDB:7ksoA	0.184	0.225	6.867E-4	395	0.055	0.068	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
13	PDB:2g46A	0.170	0.562	1.701E-3	119	0.035	0.143	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
14	PDB:5v3hA	0.110	0.122	8.702E-3	438	0.022	0.025	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
15	AFDB:Q9VW15	0.194	0.048	2.577E-2	2226	0.126	0.028	Q9VW15.pdb.gz	ASH1_DROME Histone-lysine N-methyltransferase ash1 OS=Drosophila melanogaster OX=7227 GN=ash1 PE=1 SV=3
16	AFDB:Q9BYW2	0.182	0.038	1.679E-1	2564	0.134	0.026	Q9BYW2.pdb.gz	SETD2_HUMAN Histone-lysine N-methyltransferase SETD2 OS=Homo sapiens OX=9606 GN=SETD2 PE=1 SV=3
17	AFDB:E9Q5F9	0.188	0.040	1.895E-1	2537	0.120	0.023	E9Q5F9.pdb.gz	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
18	AFDB:O60307	0.070	0.040	3.685E-1	1309	0.134	0.050	O60307.pdb.gz	MAST3_HUMAN Microtubule-associated serine/threonine-protein kinase 3 OS=Homo sapiens OX=9606 GN=MAST3 PE=1 SV=2
19	AFDB:A0A024R1F8	0.075	0.061	8.591E-1	641	0.057	0.044	A0A024R1F8.pdb.gz
20	AFDB:Q9BW04	0.060	0.050	1.030	601	0.181	0.148	Q9BW04.pdb.gz	SARG_HUMAN Specifically androgen-regulated gene protein OS=Homo sapiens OX=9606 GN=SARG PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q96EQ9	0.0	599	843	0.567	0.331	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
2	Q9NQV7	0.0	733	894	0.705	0.388	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
3	Q9NQW5	0.0	1033	492	1.000	1.000	PRDM7_HUMAN Histone-lysine N-methyltransferase PRDM7 OS=Homo sapiens OX=9606 GN=PRDM7 PE=1 SV=2
4	Q9NQV5	9.64e-42	157	511	0.148	0.143	PRD11_HUMAN PR domain-containing protein 11 OS=Homo sapiens OX=9606 GN=PRDM11 PE=1 SV=2
5	A2AGX3	1.71e-41	158	565	0.148	0.129	PRD11_MOUSE PR domain-containing protein 11 OS=Mus musculus OX=10090 GN=Prdm11 PE=1 SV=1
6	A0A163UT06	5.44e-31	123	277	0.154	0.274	SET17_CAEEL Histone-lysine N-methyltransferase set-17 OS=Caenorhabditis elegans OX=6239 GN=set-17 PE=1 SV=1
7	F1QWQ9	1.29e-19	94.0	568	0.114	0.099	F1QWQ9_DANRE PR domain zinc finger protein 14 isoform X1 OS=Danio rerio OX=7955 GN=fc16b12 PE=4 SV=1
8	E9Q3T6	4.08e-19	92.4	561	0.110	0.096	PRD14_MOUSE PR domain zinc finger protein 14 OS=Mus musculus OX=10090 GN=Prdm14 PE=1 SV=1
9	A2A7B7	2.20e-18	84.7	169	0.093	0.272	A2A7B7_MOUSE PR domain containing 2, with ZNF domain (Fragment) OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
10	Q9UKN5	8.11e-18	89.0	801	0.114	0.070	PRDM4_HUMAN PR domain zinc finger protein 4 OS=Homo sapiens OX=9606 GN=PRDM4 PE=1 SV=3
11	Q9VRN4	9.17e-18	89.0	1203	0.112	0.046	Q9VRN4_DROME Blimp-1, isoform A OS=Drosophila melanogaster OX=7227 GN=Blimp-1 PE=2 SV=1
12	Q9QZP2	1.20e-17	88.6	798	0.112	0.069	PRDM4_RAT PR domain zinc finger protein 4 OS=Rattus norvegicus OX=10116 GN=Prdm4 PE=2 SV=1
13	Q9GZV8	1.21e-17	88.2	571	0.108	0.093	PRD14_HUMAN PR domain zinc finger protein 14 OS=Homo sapiens OX=9606 GN=PRDM14 PE=1 SV=1
14	Q16384	5.55e-17	81.3	188	0.134	0.351	SSX1_HUMAN Protein SSX1 OS=Homo sapiens OX=9606 GN=SSX1 PE=1 SV=2
15	Q5U3V3	9.59e-17	84.0	366	0.093	0.126	Q5U3V3_DANRE PR domain zinc finger protein 12 OS=Danio rerio OX=7955 GN=prdm12b PE=2 SV=1
16	Q9H4Q4	1.25e-16	83.6	367	0.093	0.125	PRD12_HUMAN PR domain zinc finger protein 12 OS=Homo sapiens OX=9606 GN=PRDM12 PE=1 SV=2
17	Q3UZD5	1.39e-16	84.7	596	0.163	0.134	PRDM6_MOUSE Putative histone-lysine N-methyltransferase PRDM6 OS=Mus musculus OX=10090 GN=Prdm6 PE=1 SV=1
18	Q80V63	1.44e-16	85.1	803	0.114	0.070	PRDM4_MOUSE PR domain zinc finger protein 4 OS=Mus musculus OX=10090 GN=Prdm4 PE=2 SV=2
19	A2AJ77	1.63e-16	83.2	365	0.093	0.126	PRD12_MOUSE PR domain zinc finger protein 12 OS=Mus musculus OX=10090 GN=Prdm12 PE=2 SV=1
20	Q13029	1.96e-16	85.1	1718	0.091	0.026	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	0.00084	30.2	KRAB box
2	PF02305 Phage_F	81	13.4	Capsid protein (F protein)
3	PF00856 SET	0.5	22.2	SET domain
4	PF09514 SSXRD	1.7e-14	64.4	SSXRD motif
5	PF18445 zf_PR_Knuckle	7.2	17.8	PR zinc knuckle motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396732

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000388864	0.728	Zinc finger protein 419
2	9606.ENSP00000367755	0.697	Calmodulin-lysine N-methyltransferase
3	9606.ENSP00000196061	0.650	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 1
4	9606.ENSP00000223127	0.650	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3
5	9606.ENSP00000282903	0.650	Procollagen-lysine,2-oxoglutarate 5-dioxygenase 2
6	9606.ENSP00000360310	0.649	Meiotic recombination protein SPO11
7	9606.ENSP00000390475	0.643	CXXC-type zinc finger protein 1
8	9606.ENSP00000263187	0.642	MutS protein homolog 4
9	9606.ENSP00000389709	0.642	Probable E3 SUMO-protein ligase RNF212
10	9606.ENSP00000382794	0.623	Ring finger protein 212B
11	9606.ENSP00000282292	0.615	Zinc finger protein 773
12	9606.ENSP00000379451	0.547	Zinc finger protein 418
13	9606.ENSP00000358217	0.526	PR domain zinc finger protein 13
14	9606.ENSP00000264808	0.511	PR domain zinc finger protein 5
15	9606.ENSP00000361777	0.506	Protein SET
16	9606.ENSP00000457625	0.501	Dysbindin domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042800	0.999	histone H3K4 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0044260	0.979	cellular macromolecule metabolic process
GO:0006479	0.918	protein methylation
GO:0018022	0.905	peptidyl-lysine methylation
GO:0051568	0.876	histone H3-K4 methylation
GO:0018023	0.721	peptidyl-lysine trimethylation
GO:0065007	0.619	biological regulation
GO:0050789	0.613	regulation of biological process
GO:0050794	0.569	regulation of cellular process
GO:0019222	0.475	regulation of metabolic process
GO:0060255	0.439	regulation of macromolecule metabolic process
GO:0080090	0.405	regulation of primary metabolic process
GO:0051171	0.405	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.537	cytoplasm
GO:0043232	0.506	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:60260	0.999	L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(4)-[histone H3] + 3 S-adenosyl-L-homocysteine
EC:2.1.1.354	0.999	[histone H3]-lysine(4) N-trimethyltransferase.

[back to server]