StarFunc result for job id Q9NQX1

User Input

>input (630 residues)
MLGMYVPDRFSLKSSRVQDGMGLYTARRVRKGEKFGPFAGEKRMPEDLDENMDYRLMWEV
RGSKGEVLYILDATNPRHSNWLRFVHEAPSQEQKNLAAIQEGENIFYLAVEDIETDTELL
IGYLDSDMEAEEEEQQIMTVIKEGEVENSRRQSTAGRKDRLGCKEDYACPQCESSFTSED
ILAEHLQTLHQKPTEEKEFKCKNCGKKFPVKQALQRHVLQCTAKSSLKESSRSFQCSVCN
SSFSSASSFEQHQETCRGDARFVCKADSCGKRLKSKDALKRHQENVHTGDPKKKLICSVC
NKKCSSASSLQEHRKIHEIFDCQECMKKFISANQLKRHMITHSEKRPYNCEICNKSFKRL
DQVGAHKVIHSEDKPYKCKLCGKGFAHRNVYKNHKKTHSEERPFQCEECKALFRTPFSLQ
RHLLIHNSERTFKCHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHK
KTHTGEKEKICPYCGQKFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMHIRTHT
REKPYKCSECSKAFSQKRGLDEHKRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRP
LAECQFCHKKFTRNDYLKVHMDNIHGVADS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NQX1	1.000	1.000	0.000	630	1.000	1.000	Q9NQX1.pdb.gz	PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens OX=9606 GN=PRDM5 PE=1 SV=2
2	AFDB:Q9CXE0	0.497	0.522	9.126E-100	599	0.879	0.925	Q9CXE0.pdb.gz	PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus OX=10090 GN=Prdm5 PE=2 SV=2
3	AFDB:F1Q8J8	0.523	0.520	2.102E-93	634	0.778	0.773	F1Q8J8.pdb.gz	F1Q8J8_DANRE PR domain zinc finger protein 5 OS=Danio rerio OX=7955 GN=prdm5 PE=4 SV=1
4	AFDB:Q96EQ9	0.429	0.333	3.537E-42	843	0.298	0.223	Q96EQ9.pdb.gz	PRDM9_MOUSE Histone-lysine N-methyltransferase PRDM9 OS=Mus musculus OX=10090 GN=Prdm9 PE=1 SV=2
5	AFDB:E9Q8T2	0.279	0.158	2.868E-41	1174	0.254	0.136	E9Q8T2.pdb.gz	PRD15_MOUSE PR domain zinc finger protein 15 OS=Mus musculus OX=10090 GN=Prdm15 PE=1 SV=1
6	AFDB:Q9NQV7	0.431	0.318	1.157E-40	894	0.314	0.221	Q9NQV7.pdb.gz	PRDM9_HUMAN Histone-lysine N-methyltransferase PRDM9 OS=Homo sapiens OX=9606 GN=PRDM9 PE=1 SV=2
7	AFDB:E9Q981	0.430	0.427	1.843E-40	636	0.256	0.253	E9Q981.pdb.gz	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
8	AFDB:P17021	0.313	0.301	2.194E-40	662	0.283	0.269	P17021.pdb.gz	ZNF17_HUMAN Zinc finger protein 17 OS=Homo sapiens OX=9606 GN=ZNF17 PE=1 SV=3
9	AFDB:P57071	0.186	0.087	3.493E-40	1507	0.276	0.115	P57071.pdb.gz	PRD15_HUMAN PR domain zinc finger protein 15 OS=Homo sapiens OX=9606 GN=PRDM15 PE=1 SV=4
10	AFDB:A0A075BR52	0.318	0.318	4.158E-40	631	0.259	0.258	A0A075BR52.pdb.gz	A0A075BR52_DANRE Draculin-like 3 OS=Danio rerio OX=7955 GN=drl-L3 PE=2 SV=1
11	PDB:3w5kB	0.081	0.272	6.341E-5	110	0.063	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:7td5A	0.125	0.155	6.121E-4	497	0.049	0.062	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
13	PDB:7td5F	0.123	0.167	1.303E-3	447	0.049	0.069	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
14	PDB:2g46A	0.120	0.535	2.331E-3	119	0.027	0.143	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
15	PDB:5h6zA	0.113	0.472	2.775E-3	123	0.032	0.163	5h6zA.pdb.gz
16	PDB:5wg6A	0.117	0.140	3.117E-3	517	0.041	0.050	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
17	PDB:5hynA	0.123	0.132	3.711E-3	581	0.046	0.050	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
18	PDB:6wkrC	0.119	0.123	4.962E-3	606	0.049	0.051	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
19	PDB:7ksoA	0.120	0.180	9.969E-3	395	0.041	0.066	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
20	PDB:1pegA	0.117	0.254	1.498E-2	266	0.035	0.083	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q8J8	0.0	1015	634	0.781	0.776	F1Q8J8_DANRE PR domain zinc finger protein 5 OS=Danio rerio OX=7955 GN=prdm5 PE=4 SV=1
2	Q9CXE0	0.0	1142	599	0.881	0.927	PRDM5_MOUSE PR domain zinc finger protein 5 OS=Mus musculus OX=10090 GN=Prdm5 PE=2 SV=2
3	Q9NQX1	0.0	1308	630	1.000	1.000	PRDM5_HUMAN PR domain zinc finger protein 5 OS=Homo sapiens OX=9606 GN=PRDM5 PE=1 SV=2
4	A0A0U1RQ46	6.79e-91	295	609	0.271	0.281	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
5	Q05481	1.66e-90	306	1191	0.295	0.156	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
6	Q9P2J8	5.40e-90	299	865	0.279	0.203	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
7	A6NNF4	5.42e-89	290	616	0.271	0.278	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
8	Q7TMN8	1.38e-88	288	578	0.273	0.298	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
9	Q8BLA2	3.28e-88	287	578	0.273	0.298	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
10	Q49A12	3.30e-87	283	536	0.257	0.302	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
11	Q03923	3.32e-87	285	595	0.257	0.272	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
12	Q8TAQ5	4.42e-87	287	688	0.278	0.254	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
13	Q3KP31	5.66e-87	284	576	0.279	0.306	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
14	P51523	8.23e-87	288	738	0.298	0.255	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
15	G3V9G6	1.22e-86	287	740	0.270	0.230	G3V9G6_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=4
16	A0A8I6G8Y2	1.30e-86	287	723	0.270	0.235	A0A8I6G8Y2_RAT Zinc finger protein 111 OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=4 SV=1
17	Q62788	1.39e-86	287	744	0.270	0.228	Q62788_RAT Cys2/His2 zinc finger protein OS=Rattus norvegicus OX=10116 GN=Zfp111 PE=2 SV=1
18	E9QAG8	1.82e-86	281	526	0.254	0.304	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
19	P35789	3.58e-86	283	620	0.257	0.261	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
20	Q6ECI4	2.07e-85	284	717	0.273	0.240	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	1.2e+02	14.5	BolA-like protein
2	PF14471 DUF4428	4	18.7	Domain of unknown function (DUF4428)
3	PF03966 Trm112p	5.8e+02	12.5	Trm112p-like protein
4	PF00096 zf-C2H2	1.1e-60	209.9	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	8.1e-11	52.8	zinc-finger C2H2-type
6	PF18868 zf-C2H2_3rep	4.5	19.4	Zinc finger C2H2-type, 3 repeats
7	PF13894 zf-C2H2_4	2.3e-51	179.0	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	9.4e-20	81.4	C2H2-type zinc finger
9	PF15909 zf-C2H2_8	7.1	18.4	C2H2-type zinc ribbon
10	PF12171 zf-C2H2_jaz	4.3e-24	95.5	Zinc-finger double-stranded RNA-binding
11	PF13913 zf-C2HC_2	9e+02	11.2	zinc-finger of a C2HC-type
12	PF05605 zf-Di19	5.4e-07	41.1	Drought induced 19 protein (Di19), zinc-binding
13	PF13465 zf-H2C2_2	4.1e-61	212.1	Zinc-finger double domain
14	PF12874 zf-met	3e-21	86.3	Zinc-finger of C2H2 type
15	PF18439 zf_UBZ	1.4	19.9	Ubiquitin-Binding Zinc Finger
16	PF14369 zinc_ribbon_9	4.8e+02	12.4	zinc-ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264808

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480626	0.791	PR domain-containing protein 11
2	9606.ENSP00000362649	0.698	Histone deacetylase 1
3	9606.ENSP00000376568	0.695	Myeloid leukemia factor 1
4	9606.ENSP00000357787	0.694	Uroporphyrinogen-III synthase
5	9606.ENSP00000301457	0.681	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
6	9606.ENSP00000373610	0.644	Otoancorin
7	9606.ENSP00000265023	0.642	Kininogen-1
8	9606.ENSP00000339764	0.629	PR domain zinc finger protein 8
9	9606.ENSP00000264377	0.598	Disintegrin and metalloproteinase domain-containing protein 23
10	9606.ENSP00000280258	0.575	Serine protease 23
11	9606.ENSP00000253968	0.574	Homeobox protein BarH-like 1
12	9606.ENSP00000462269	0.569	Zinc finger protein 488
13	9606.ENSP00000228437	0.555	PR domain zinc finger protein 4
14	9606.ENSP00000382163	0.549	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
15	9606.ENSP00000385852	0.546	SET domain-containing protein 5
16	9606.ENSP00000296591	0.534	EGF-like repeat and discoidin I-like domain-containing protein 3
17	9606.ENSP00000261523	0.531	Nuclear receptor ROR-alpha
18	9606.ENSP00000364678	0.531	Histone-lysine N-methyltransferase EHMT2
19	9606.ENSP00000264010	0.529	Transcriptional repressor CTCF
20	9606.ENSP00000482442	0.519	FXYD domain containing ion transport regulator 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140297	0.998	DNA-binding transcription factor binding
GO:0001227	0.996	DNA-binding transcription repressor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0009889	0.986	regulation of biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0009987	0.903	cellular process
GO:0048856	0.769	anatomical structure development
GO:0007275	0.762	multicellular organism development
GO:0048513	0.665	animal organ development
GO:0048518	0.627	positive regulation of biological process
GO:0023051	0.588	regulation of signaling
GO:0010646	0.579	regulation of cell communication
GO:0048519	0.535	negative regulation of biological process
GO:0048523	0.531	negative regulation of cellular process
GO:0048522	0.500	positive regulation of cellular process
GO:0050896	0.491	response to stimulus
GO:0048583	0.427	regulation of response to stimulus
GO:0006357	0.413	regulation of transcription by RNA polymerase II
GO:0045892	0.363	negative regulation of DNA-templated transcription
GO:0010604	0.335	positive regulation of macromolecule metabolic process
GO:0045935	0.331	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.992	nucleoplasm
GO:0043232	0.953	intracellular non-membrane-bounded organelle
GO:0005730	0.696	nucleolus
GO:0005737	0.547	cytoplasm
GO:0016604	0.442	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]