StarFunc result for job id Q9NQX3

User Input

>input (736 residues)
MATEGMILTNHDHQIRVGVLTVSDSCFRNLAEDRSGINLKDLVQDPSLLGGTISAYKIVP
DEIEEIKETLIDWCDEKELNLILTTGGTGFAPRDVTPEATKEVIEREAPGMALAMLMGSL
NVTPLGMLSRPVCGIRGKTLIINLPGSKKGSQECFQFILPALPHAIDLLRDAIVKVKEVH
DELEDLPSPPPPLSPPPTTSPHKQTEDKGVQCEEEEEEKKDSGVASTEDSSSSHITAAAI
AAKIPDSIISRGVQVLPRDTASLSTTPSESPRAQATSRLSTASCPTPKVQSRCSSKENIL
RASHSAVDITKVARRHRMSPFPLTSMDKAFITVLEMTPVLGTEIINYRDGMGRVLAQDVY
AKDNLPPFPASVKDGYAVRAADGPGDRFIIGESQAGEQPTQTVMPGQVMRVTTGAPIPCG
ADAVVQVEDTELIRESDDGTEELEVRILVQARPGQDIRPIGHDIKRGECVLAKGTHMGPS
EIGLLATVGVTEVEVNKFPVVAVMSTGNELLNPEDDLLPGKIRDSNRSTLLATIQEHGYP
TINLGIVGDNPDDLLNALNEGISRADVIITSGGVSMGEKDYLKQVLDIDLHAQIHFGRVF
MKPGLPTTFATLDIDGVRKIIFALPGNPVSAVVTCNLFVVPALRKMQGILDPRPTIIKAR
LSCDVKLDPRPEYHRCILTWHHQEPLPWAQSTGNQMSSRLMSMRSANGLLMLPPKTEQYV
ELHKGEVVDVMVIGRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4INA6	0.824	0.704	0.000	868	0.966	0.819	A0A0R4INA6.pdb.gz	A0A0R4INA6_DANRE Gephyrin a OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
2	AFDB:A0A2R8QMT4	0.669	0.587	0.000	847	0.966	0.839	A0A2R8QMT4.pdb.gz
3	AFDB:A0A2R8RZ21	0.489	0.449	0.000	803	0.920	0.843	A0A2R8RZ21.pdb.gz
4	AFDB:D3KYK8	0.605	0.576	0.000	774	0.966	0.919	D3KYK8.pdb.gz	D3KYK8_DANRE Gephyrin a OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
5	AFDB:D3KYL0	0.613	0.541	0.000	834	0.966	0.853	D3KYL0.pdb.gz	D3KYL0_DANRE Gephyrin OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
6	AFDB:D3KYL1	0.606	0.606	0.000	736	0.959	0.959	D3KYL1.pdb.gz	D3KYL1_DANRE Gephyrin b OS=Danio rerio OX=7955 GN=gphn2 PE=1 SV=1
7	AFDB:D3KYL2	0.780	0.724	0.000	796	0.958	0.886	D3KYL2.pdb.gz	D3KYL2_DANRE Gephyrin b OS=Danio rerio OX=7955 GN=fj59a01 PE=1 SV=1
8	AFDB:Q8BUV3	0.823	0.789	0.000	769	0.997	0.954	Q8BUV3.pdb.gz	GEPH_MOUSE Gephyrin OS=Mus musculus OX=10090 GN=Gphn PE=1 SV=2
9	AFDB:G5EB65	0.551	0.571	3.149E-74	709	0.365	0.379	G5EB65.pdb.gz	G5EB65_EMENI MoaB/Mog domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03778 PE=3 SV=1
10	AFDB:P39205	0.492	0.597	5.293E-67	601	0.314	0.384	P39205.pdb.gz	CIN_DROME Molybdenum cofactor synthesis protein cinnamon OS=Drosophila melanogaster OX=7227 GN=cin PE=1 SV=3
11	PDB:2nqnA	0.469	0.808	5.776E-41	405	0.198	0.360	2nqnA.pdb.gz
12	PDB:2nqmA	0.400	0.879	2.053E-29	322	0.151	0.345	2nqmA.pdb.gz
13	PDB:1di7A	0.178	0.684	2.447E-13	185	0.075	0.297	1di7A.pdb.gz
14	PDB:1mkzB	0.185	0.776	2.909E-12	171	0.058	0.251	1mkzB.pdb.gz
15	PDB:1d7lA	0.062	0.100	2.451E-2	394	0.038	0.071	1d7lA.pdb.gz	Structure-function correlations of the reaction of reduced nicotinamide analogues with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins.
16	PDB:2bonB	0.111	0.260	2.451E-2	265	0.042	0.117	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
17	PDB:2f17A	0.072	0.155	3.086E-2	255	0.042	0.122	2f17A.pdb.gz	Pyrithiamine as a substrate for thiamine pyrophosphokinase
18	PDB:1mwiA	0.124	0.418	6.158E-2	165	0.027	0.121	1mwiA.pdb.gz	Crystal structure of a G:T/U mismatch-specific DNA glycosylase: mismatch recognition by complementary-strand interactions.
19	PDB:3s4yA	0.090	0.224	6.158E-2	224	0.039	0.129	3s4yA.pdb.gz	Crystal structure of human thiamin pyrophosphokinase 1
20	PDB:7po27	0.109	0.136	6.909E-2	571	0.027	0.035	7po27.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4INA6	0.0	1372	868	0.957	0.811	A0A0R4INA6_DANRE Gephyrin a OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
2	D3KYK7	0.0	1454	735	0.967	0.969	D3KYK7_DANRE Gephyrin a OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
3	D3KYK8	0.0	1434	774	0.967	0.920	D3KYK8_DANRE Gephyrin a OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
4	D3KYK9	0.0	1409	795	0.957	0.886	D3KYK9_DANRE Gephyrin a OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
5	D3KYL0	0.0	1390	834	0.957	0.844	D3KYL0_DANRE Gephyrin OS=Danio rerio OX=7955 GN=gpgb1 PE=1 SV=1
6	D3KYL1	0.0	1407	736	0.959	0.959	D3KYL1_DANRE Gephyrin b OS=Danio rerio OX=7955 GN=gphn2 PE=1 SV=1
7	D3KYL2	0.0	1395	796	0.943	0.872	D3KYL2_DANRE Gephyrin b OS=Danio rerio OX=7955 GN=fj59a01 PE=1 SV=1
8	Q03555	0.0	1477	768	0.999	0.957	GEPH_RAT Gephyrin OS=Rattus norvegicus OX=10116 GN=Gphn PE=1 SV=3
9	Q8BUV3	0.0	1484	769	0.999	0.956	GEPH_MOUSE Gephyrin OS=Mus musculus OX=10090 GN=Gphn PE=1 SV=2
10	Q9NQX3	0.0	1500	736	1.000	1.000	GEPH_HUMAN Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1
11	Q39054	3.91e-106	340	670	0.258	0.284	CNX1_ARATH Molybdopterin biosynthesis protein CNX1 OS=Arabidopsis thaliana OX=3702 GN=CNX1 PE=1 SV=2
12	G5EB65	1.22e-84	284	709	0.258	0.268	G5EB65_EMENI MoaB/Mog domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_03778 PE=3 SV=1
13	P39205	3.83e-66	232	601	0.207	0.253	CIN_DROME Molybdenum cofactor synthesis protein cinnamon OS=Drosophila melanogaster OX=7227 GN=cin PE=1 SV=3
14	P12281	6.41e-55	196	411	0.201	0.360	MOEA_ECOLI Molybdopterin molybdenumtransferase OS=Escherichia coli (strain K12) OX=83333 GN=moeA PE=1 SV=1
15	P9WJQ7	3.15e-31	129	426	0.174	0.300	MOEA1_MYCTU Molybdopterin molybdenumtransferase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moeA1 PE=1 SV=1
16	G5EF06	3.08e-29	122	391	0.124	0.233	G5EF06_CAEEL LIN-46 OS=Caenorhabditis elegans OX=6239 GN=lin-46 PE=1 SV=1
17	P0AF03	1.73e-20	92.0	195	0.082	0.308	MOG_ECOLI Molybdopterin adenylyltransferase OS=Escherichia coli (strain K12) OX=83333 GN=mog PE=1 SV=1
18	P0AEZ9	3.73e-12	67.4	170	0.062	0.271	MOAB_ECOLI Molybdenum cofactor biosynthesis protein B OS=Escherichia coli (strain K12) OX=83333 GN=moaB PE=1 SV=2
19	O53897	1.35e-11	66.2	181	0.061	0.249	O53897_MYCTU MoaB/Mog domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=moaB2 PE=1 SV=3
20	Q03219	0.11	37.7	274	0.020	0.055	YM44_YEAST Uncharacterized protein YMR178W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR178W PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00994 MoCF_biosynth	6.3e-66	231.9	Probable molybdopterin binding domain
2	PF03454 MoeA_C	6.3e-20	82.5	MoeA C-terminal region (domain IV)
3	PF03453 MoeA_N	5.4e-38	141.7	MoeA N-terminal region (domain I and II)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9544.ENSMMUP00000012446

Rank	PPI partner	STRING score	Description
1	9544.ENSMMUP00000030159	0.978	Glycine receptor subunit beta isoform A
2	9544.ENSMMUP00000034735	0.972	Molybdopterin synthase catalytic subunit
3	9544.ENSMMUP00000028082	0.955	Uncharacterized protein
4	9544.ENSMMUP00000020495	0.909	Uncharacterized protein
5	9544.ENSMMUP00000033762	0.905	Gamma-aminobutyric acid receptor subunit alpha-1
6	9544.ENSMMUP00000019287	0.889	Uncharacterized protein
7	9544.ENSMMUP00000012702	0.880	Gamma-aminobutyric acid receptor subunit gamma-2 isoform 1
8	9544.ENSMMUP00000021335	0.871	Cdc42 guanine nucleotide exchange factor (GEF) 9
9	9544.ENSMMUP00000011630	0.851	Glycine receptor alpha 3
10	9544.ENSMMUP00000013811	0.846	Discs, large homolog 4 (Drosophila)
11	9544.ENSMMUP00000031002	0.828	Gamma-aminobutyric acid (GABA) A receptor, alpha 5
12	9544.ENSMMUP00000004824	0.822	GABA(A) receptor subunit alpha-2
13	9544.ENSMMUP00000003786	0.821	Gamma-aminobutyric acid type A receptor alpha6 subunit
14	9544.ENSMMUP00000006270	0.819	glycyl-tRNA synthetase
15	9544.ENSMMUP00000008033	0.812	Glycine receptor, alpha 4
16	9544.ENSMMUP00000004644	0.789	Glycine receptor subunit alpha-2 isoform A
17	9544.ENSMMUP00000012458	0.789	Gamma-aminobutyric acid type A receptor alpha4 subunit
18	9544.ENSMMUP00000009871	0.788	Uncharacterized protein
19	9544.ENSMMUP00000001597	0.781	Dynein light chain 1, cytoplasmic
20	9544.ENSMMUP00000004498	0.753	GABA and glycine transporter

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	0.999	catalytic activity
GO:0008092	0.999	cytoskeletal protein binding
GO:0042802	0.998	identical protein binding
GO:0016661	0.993	oxidoreductase activity, acting on other nitrogenous compounds as donors
GO:0005198	0.990	structural molecule activity
GO:0043546	0.989	molybdopterin cofactor binding
GO:0098918	0.984	structural constituent of synapse
GO:0099186	0.972	structural constituent of postsynapse
GO:0008940	0.910	nitrate reductase activity
GO:0016740	0.613	transferase activity
GO:0098879	0.408	structural constituent of postsynaptic specialization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051641	0.988	cellular localization
GO:0033036	0.986	macromolecule localization
GO:0099173	0.980	postsynapse organization
GO:0008104	0.978	protein localization
GO:0043113	0.968	receptor clustering
GO:0001941	0.962	postsynaptic membrane organization
GO:0065007	0.356	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098794	1.000	postsynapse
GO:0005886	1.000	plasma membrane
GO:0043229	0.999	intracellular organelle
GO:0005829	0.991	cytosol
GO:0043232	0.989	intracellular non-membrane-bounded organelle
GO:0043227	0.951	membrane-bounded organelle
GO:0120025	0.933	plasma membrane bounded cell projection
GO:0043005	0.882	neuron projection
GO:0043231	0.882	intracellular membrane-bounded organelle
GO:0036477	0.838	somatodendritic compartment
GO:0098590	0.830	plasma membrane region
GO:0097447	0.826	dendritic tree
GO:0099572	0.793	postsynaptic specialization
GO:0097060	0.782	synaptic membrane
GO:0030425	0.774	dendrite
GO:0032991	0.752	protein-containing complex
GO:0060077	0.595	inhibitory synapse
GO:0019898	0.487	extrinsic component of membrane
GO:0012505	0.484	endomembrane system
GO:0098982	0.471	GABA-ergic synapse
GO:0070013	0.428	intracellular organelle lumen
GO:0031981	0.423	nuclear lumen
GO:0044297	0.395	cell body
GO:0032279	0.391	asymmetric synapse
GO:0099091	0.365	postsynaptic specialization, intracellular component
GO:0014069	0.326	postsynaptic density
GO:0043025	0.302	neuronal cell body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.7.-.-	0.993	Acting on other nitrogenous compounds as donors.
RHEA:21068	0.910	A + H2O + nitrite = AH2 + nitrate
EC:1.7.99.4	0.910	1.9.6.1.
EC:2.-.-.-	0.613	Transferases.

[back to server]