StarFunc result for job id Q9NQX4

User Input

>input (1742 residues)
MAVAELYTQYNRVWIPDPEEVWKSAEIAKDYRVGDKVLRLLLEDGTELDYSVNPESLPPL
RNPDILVGENDLTALSYLHEPAVLHNLRIRFAESKLIYTYSGIILVAMNPYKQLPIYGDA
IIHAYSGQNMGDMDPHIFAVAEEAYKQMARNNRNQSIIVSGESGAGKTVSARYAMRYFAT
VSKSGSNAHVEDKVLASNPITEAVGNAKTTRNDNSSRFGKYTEISFDEQNQIIGANMSTY
LLEKSRVVFQSENERNYHIFYQLCASAQQSEFKHLKLGSAEEFNYTRMGGNTVIEGVNDR
AEMVETQKTFTLLGFKEDFQMDVFKILAAILHLGNVQITAVGNERSSVSEDDSHLKVFCE
LLGLESGRVAQWLCNRKIVTSSETVVKPMTRPQAVNARDALAKKIYAHLFDFIVERINQA
LQFSGKQHTFIGVLDIYGFETFDVNSFEQFCINYANEKLQQQFNMHVFKLEQEEYMKEDI
PWTLIDFYDNQPVIDLIEAKMGILELLDEECLLPHGTDENWLQKLYNNFVNRNPLFEKPR
MSNTSFVIQHFADKVEYKCEGFLEKNRDTVYDMLVEILRASKFHLCANFFQENPTPPSPF
GSMITVKSAKQVIKPNSKHFRTTVGSKFRSSLYLLMETLNATTPHYVRCIKPNDEKLPFE
FDSKRIVQQLRACGVLETIRISAQSYPSRWTYIEFYSRYGILMTKQELSFSDKKEVCKVV
LHRLIQDSNQYQFGKTKIFFRAGQVAYLEKLRLDKLRQSCVMVQKHMRGWLQRKKFLRER
RAALIIQQYFRGQQTVRKAITAVALKEAWAAIIIQKHCRGYLVRSLYQLIRMATITMQAY
SRGFLARRRYRKMLEEHKAVILQKYARAWLARRRFQSIRRFVLNIQLTYRVQRLQKKLED
QNKENHGLVEKLTSLAALRAGDVEKIQKLEAELEKAATHRRNYEEKGKRYRDAVEEKLAK
LQKHNSELETQKEQIQLKLQEKTEELKEKMDNLTKQLFDDVQKEERQRMLLEKSFELKTQ
DYEKQIQSLKEEIKALKDEKMQLQHLVEGEHVTSDGLKAEVARLSKQVKTISEFEKEIEL
LQAQKIDVEKHVQSQKREMREKMSEITKQLLESYDIEDVRSRLSVEDLEHLNEDGELWFA
YEGLKKATRVLESHFQSQKDCYEKEIEALNFKVVHLSQEINHLQKLFREENDINESIRHE
VTRLTSENMMIPDFKQQISELEKQKQDLEIRLNEQAEKMKGKLEELSNQLHRSQEEEGTQ
RKALEAQNEIHTKEKEKLIDKIQEMQEASDHLKKQFETESEVKCNFRQEASRLTLENRDL
EEELDMKDRVIKKLQDQVKTLSKTIGKANDVHSSSGPKEYLGMLQYKREDEAKLIQNLIL
DLKPRGVVVNMIPGLPAHILFMCVRYADSLNDANMLKSLMNSTINGIKQVVKEHLEDFEM
LSFWLSNTCHFLNCLKQYSGEEEFMKHNSPQQNKNCLNNFDLSEYRQILSDVAIRIYHQF
IIIMEKNIQPIIVPGMLEYESLQGISGLKPTGFRKRSSSIDDTDGYTMTSVLQQLSYFYT
TMCQNGLDPELVRQAVKQLFFLIGAVTLNSLFLRKDMCSCRKGMQIRCNISYLEEWLKDK
NLQNSLAKETLEPLSQAAWLLQVKKTTDSDAKEIYERCTSLSAVQIIKILNSYTPIDDFE
KRVTPSFVRKVQALLNSREDSSQLMLDTKYLFQVTFPFTPSPHALEMIQIPSSFKLGFLN
RL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IPW9	0.494	0.470	0.000	1839	0.506	0.480	A0A0R4IPW9.pdb.gz
2	AFDB:A1Z6Z8	0.444	0.433	0.000	1800	0.390	0.377	A1Z6Z8.pdb.gz	A1Z6Z8_DROME Dilute class unconventional myosin, isoform C OS=Drosophila melanogaster OX=7227 GN=didum PE=1 SV=1
3	AFDB:P21271	0.438	0.420	0.000	1818	0.502	0.481	P21271.pdb.gz	MYO5B_MOUSE Unconventional myosin-Vb OS=Mus musculus OX=10090 GN=Myo5b PE=1 SV=2
4	AFDB:P70569	0.440	0.415	0.000	1846	0.509	0.480	P70569.pdb.gz	MYO5B_RAT Unconventional myosin-Vb OS=Rattus norvegicus OX=10116 GN=Myo5b PE=1 SV=1
5	AFDB:Q02440	0.436	0.416	0.000	1829	0.538	0.512	Q02440.pdb.gz	MYO5A_CHICK Unconventional myosin-Va OS=Gallus gallus OX=9031 GN=MYO5A PE=1 SV=1
6	AFDB:Q9NQX4	1.000	1.000	0.000	1742	1.000	1.000	Q9NQX4.pdb.gz	MYO5C_HUMAN Unconventional myosin-Vc OS=Homo sapiens OX=9606 GN=MYO5C PE=1 SV=2
7	AFDB:Q9Y4I1	0.438	0.412	0.000	1855	0.533	0.500	Q9Y4I1.pdb.gz	MYO5A_HUMAN Unconventional myosin-Va OS=Homo sapiens OX=9606 GN=MYO5A PE=1 SV=2
8	AFDB:Q5AKW2	0.440	0.490	7.626E-98	1561	0.314	0.350	Q5AKW2.pdb.gz	Q5AKW2_CANAL Myosin 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO2 PE=3 SV=1
9	AFDB:P19524	0.429	0.474	1.112E-96	1574	0.319	0.353	P19524.pdb.gz	MYO2_YEAST Myosin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO2 PE=1 SV=1
10	AFDB:P32492	0.439	0.517	5.249E-89	1471	0.274	0.324	P32492.pdb.gz	MYO4_YEAST Myosin-4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MYO4 PE=1 SV=1
11	PDB:4pa0A	0.392	0.690	1.072E-60	974	0.164	0.294	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
12	PDB:4pa0B	0.386	0.721	2.542E-60	920	0.160	0.303	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4p7hB	0.379	0.684	1.360E-56	952	0.162	0.296	4p7hB.pdb.gz
14	PDB:4anjA	0.343	0.586	5.314E-56	995	0.156	0.272	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
15	PDB:6ycxB	0.357	0.739	1.977E-52	817	0.137	0.291	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
16	PDB:7mf3B	0.356	0.669	4.006E-47	896	0.185	0.360	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
17	PDB:5tbyA	0.344	0.599	9.496E-47	954	0.190	0.347	5tbyA.pdb.gz
18	PDB:7qpgW	0.124	0.251	2.900E-2	779	0.027	0.060	7qpgW.pdb.gz
19	PDB:7kw7E	0.062	0.183	6.875E-2	327	0.020	0.104	7kw7E.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
20	PDB:5yfpC	0.122	0.235	1.630E-1	794	0.024	0.052	5yfpC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A1Z6Z8	1103	1800	0.404	0.391	A1Z6Z8_DROME Dilute class unconventional myosin, isoform C OS=Drosophila melanogaster OX=7227 GN=didum PE=1 SV=1
2	A1Z6Z9	909	1792	0.289	0.281	A1Z6Z9_DROME Dilute class unconventional myosin, isoform A OS=Drosophila melanogaster OX=7227 GN=didum PE=1 SV=1
3	A1Z700	907	1196	0.289	0.421	A1Z700_DROME Dilute class unconventional myosin, isoform B OS=Drosophila melanogaster OX=7227 GN=didum PE=3 SV=1
4	B0CN59	657	1512	0.223	0.257	B0CN59_NICBE Myosin XI-2 OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
5	B0CN60	652	1569	0.236	0.262	B0CN60_NICBE Myosin XI-F OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
6	B0CN61	654	1529	0.235	0.267	B0CN61_NICBE Myosin XI-K OS=Nicotiana benthamiana OX=4100 PE=2 SV=1
7	F1QKS0	1672	1838	0.529	0.502	F1QKS0_DANRE Myosin VB OS=Danio rerio OX=7955 GN=cb1077 PE=3 SV=3
8	F4HWY6	634	1529	0.230	0.262	MYO11_ARATH Myosin-11 OS=Arabidopsis thaliana OX=3702 GN=XI-E PE=3 SV=1
9	F4HXP9	641	1538	0.222	0.252	MYO9_ARATH Myosin-9 OS=Arabidopsis thaliana OX=3702 GN=XI-C PE=2 SV=1
10	F4I460	656	1500	0.224	0.261	MYO8_ARATH Myosin-8 OS=Arabidopsis thaliana OX=3702 GN=XI-B PE=3 SV=1
11	F4I507	614	1153	0.199	0.300	MYO3_ARATH Myosin-3 OS=Arabidopsis thaliana OX=3702 GN=VIII-A PE=2 SV=1
12	F4I5Q6	647	1730	0.241	0.243	MYO7_ARATH Myosin-7 OS=Arabidopsis thaliana OX=3702 GN=XI-A PE=3 SV=1
13	F4IRU3	659	1556	0.237	0.265	MYO12_ARATH Myosin-12 OS=Arabidopsis thaliana OX=3702 GN=XI-F PE=2 SV=1
14	F4IUG9	637	1493	0.236	0.275	MYO13_ARATH Myosin-13 OS=Arabidopsis thaliana OX=3702 GN=XI-G PE=3 SV=1
15	F4IVR7	636	1770	0.231	0.228	MYO10_ARATH Myosin-10 OS=Arabidopsis thaliana OX=3702 GN=XI-D PE=3 SV=1
16	F4JM19	635	1516	0.218	0.251	MYO14_ARATH Myosin-14 OS=Arabidopsis thaliana OX=3702 GN=XI-H PE=3 SV=1
17	F4K0A6	585	1220	0.195	0.279	MYO2_ARATH Myosin-2 OS=Arabidopsis thaliana OX=3702 GN=VIII-2 PE=2 SV=1
18	F4K5J1	649	1531	0.234	0.266	MYO17_ARATH Myosin-17 OS=Arabidopsis thaliana OX=3702 GN=XI-K PE=1 SV=2
19	F4K7C5	667	1565	0.228	0.254	F4K7C5_ARATH Myosin 2 OS=Arabidopsis thaliana OX=3702 GN=MYA2 PE=1 SV=1
20	O74805	659	1471	0.216	0.256	MYO51_SCHPO Myosin-51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=myo51 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	2.3e+02	13.5	AAA ATPase domain
2	PF13401 AAA_22	2.2e+02	13.5	AAA domain
3	PF18504 Csm1_N	13	17.6	Csm1 N-terminal domain
4	PF01843 DIL	2.9e-24	96.6	DIL domain
5	PF00612 IQ	3.7e-14	62.1	IQ calmodulin-binding motif
6	PF00063 Myosin_head	1.8e-267	900.7	Myosin head (motor domain)
7	PF02736 Myosin_N	1	20.5	Myosin N-terminal SH3-like domain
8	PF11463 R-HINP1I	1.2	20.3	R.HinP1I restriction endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261839

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261890	0.892	Ras-related protein Rab-11A
2	9606.ENSP00000356465	0.849	Ras-related protein Rab-32
3	9606.ENSP00000300935	0.845	Ras-related protein Rab-8A
4	9606.ENSP00000458162	0.841	Actin, cytoplasmic 2
5	9606.ENSP00000349960	0.760	Actin, cytoplasmic 1
6	9606.ENSP00000296603	0.752	Recruited to ligand-activated beta-2 adrenergic receptor/ADRB2, it negatively regulates the adrenergic receptor signaling pathway . May also regulate other G-protein coupled receptors including type-1 angiotensin II receptor/AGTR1 (Probable)
7	9606.ENSP00000443598	0.727	Protein FAM214A
8	9606.ENSP00000354376	0.712	Ras-related protein Rab-25
9	9606.ENSP00000357336	0.707	RUN and SH3 domain-containing protein 1
10	9606.ENSP00000263168	0.703	F-actin-capping protein subunit alpha-1
11	9606.ENSP00000268989	0.703	Small G protein signaling modulator 2
12	9606.ENSP00000333547	0.700	Ras-related protein Rab-11B
13	9606.ENSP00000259365	0.694	Tropomodulin-1
14	9606.ENSP00000410862	0.691	RUN domain-containing protein 3A
15	9606.ENSP00000384398	0.684	RNA-binding protein MEX3D
16	9606.ENSP00000253861	0.678	Exocyst complex component 4
17	9606.ENSP00000272298	0.667	Calmodulin 2 (phosphorylase kinase, delta)
18	9606.ENSP00000291295	0.667	Calmodulin 3 (phosphorylase kinase, delta)
19	9606.ENSP00000349467	0.667	Calmodulin-1
20	9606.ENSP00000308753	0.661	Tropomodulin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0000146	0.997	microfilament motor activity
GO:0019899	0.994	enzyme binding
GO:0008092	0.970	cytoskeletal protein binding
GO:0051020	0.902	GTPase binding
GO:0097159	0.791	organic cyclic compound binding
GO:0003779	0.786	actin binding
GO:1901363	0.758	heterocyclic compound binding
GO:0043167	0.753	ion binding
GO:0031267	0.733	small GTPase binding
GO:0032555	0.517	purine ribonucleotide binding
GO:0043168	0.507	anion binding
GO:0035639	0.427	purine ribonucleoside triphosphate binding
GO:0005524	0.388	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0051179	0.968	localization
GO:0065007	0.951	biological regulation
GO:0050789	0.896	regulation of biological process
GO:0051641	0.887	cellular localization
GO:0051234	0.871	establishment of localization
GO:0050794	0.862	regulation of cellular process
GO:0030029	0.821	actin filament-based process
GO:0006810	0.803	transport
GO:0071840	0.796	cellular component organization or biogenesis
GO:0016043	0.758	cellular component organization
GO:0033036	0.744	macromolecule localization
GO:0051649	0.641	establishment of localization in cell
GO:0046907	0.608	intracellular transport
GO:0032501	0.575	multicellular organismal process
GO:0032502	0.533	developmental process
GO:0030048	0.496	actin filament-based movement
GO:0048518	0.387	positive regulation of biological process
GO:0048856	0.385	anatomical structure development
GO:0048522	0.358	positive regulation of cellular process
GO:0006996	0.333	organelle organization
GO:0030705	0.308	cytoskeleton-dependent intracellular transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005856	0.997	cytoskeleton
GO:0031982	0.994	vesicle
GO:0015629	0.994	actin cytoskeleton
GO:0005829	0.990	cytosol
GO:0032991	0.985	protein-containing complex
GO:0016020	0.984	membrane
GO:0012505	0.984	endomembrane system
GO:0031410	0.980	cytoplasmic vesicle
GO:0030054	0.952	cell junction
GO:0005576	0.934	extracellular region
GO:0005615	0.919	extracellular space
GO:0071944	0.881	cell periphery
GO:0043230	0.852	extracellular organelle
GO:1903561	0.838	extracellular vesicle
GO:0042995	0.819	cell projection
GO:0070062	0.812	extracellular exosome
GO:0099080	0.747	supramolecular complex
GO:0099512	0.735	supramolecular fiber
GO:0005886	0.680	plasma membrane
GO:0120025	0.661	plasma membrane bounded cell projection
GO:0044297	0.650	cell body
GO:0045202	0.558	synapse
GO:0016459	0.514	myosin complex
GO:0005884	0.488	actin filament
GO:0036477	0.436	somatodendritic compartment
GO:0005768	0.405	endosome
GO:0031090	0.393	organelle membrane
GO:0005634	0.355	nucleus
GO:0055037	0.310	recycling endosome
GO:0098794	0.307	postsynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.997	myosin ATPase.

[back to server]