StarFunc result for job id Q9NQX7

User Input

>input (267 residues)
MVKISFQPAVAGIKGDKADKASASAPAPASATEILLTPAREEQPPQHRSKRGGSVGGVCY
LSMGMVVLLMGLVFASVYIYRYFFLAQLARDNFFRCGVLYEDSLSSQVRTQMELEEDVKI
YLDENYERINVPVPQFGGGDPADIIHDFQRGLTAYHDISLDKCYVIELNTTIVLPPRNFW
ELLMNVKRGTYLPQTYIIQEEMVVTEHVSDKEALGSFIYHLCNGKDTYRLRRRATRRRIN
KRGAKNCNAIRHFENTFVVETLICGVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91VK4	0.840	0.834	1.467E-47	269	0.936	0.929	Q91VK4.pdb.gz	ITM2C_MOUSE Integral membrane protein 2C OS=Mus musculus OX=10090 GN=Itm2c PE=1 SV=2
2	AFDB:A0A384MDP7	0.602	0.604	8.102E-30	266	0.446	0.447	A0A384MDP7.pdb.gz	A0A384MDP7_HUMAN Integral membrane protein 2 OS=Homo sapiens OX=9606 PE=2 SV=1
3	AFDB:O43736	0.597	0.606	1.870E-24	263	0.337	0.342	O43736.pdb.gz	ITM2A_HUMAN Integral membrane protein 2A OS=Homo sapiens OX=9606 GN=ITM2A PE=1 SV=2
4	AFDB:Q9VPT9	0.549	0.468	1.237E-15	319	0.206	0.172	Q9VPT9.pdb.gz	Q9VPT9_DROME Integral membrane protein 2 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3662 PE=1 SV=1
5	AFDB:Q86XP6	0.492	0.677	6.742E-12	184	0.116	0.168	Q86XP6.pdb.gz	GKN2_HUMAN Gastrokine-2 OS=Homo sapiens OX=9606 GN=GKN2 PE=1 SV=2
6	AFDB:Q9CR36	0.470	0.607	8.036E-12	201	0.139	0.184	Q9CR36.pdb.gz	GKN1_MOUSE Gastrokine-1 OS=Mus musculus OX=10090 GN=Gkn1 PE=2 SV=3
7	AFDB:Q6PL45	0.453	0.464	2.050E-11	260	0.176	0.181	Q6PL45.pdb.gz	BRID5_HUMAN BRICHOS domain-containing protein 5 OS=Homo sapiens OX=9606 GN=BRICD5 PE=1 SV=3
8	AFDB:Q9CQS6	0.486	0.675	1.119E-10	184	0.105	0.152	Q9CQS6.pdb.gz	GKN2_MOUSE Gastrokine-2 OS=Mus musculus OX=10090 GN=Gkn2 PE=1 SV=1
9	AFDB:Q9NS71	0.467	0.602	2.009E-10	199	0.120	0.161	Q9NS71.pdb.gz	GKN1_HUMAN Gastrokine-1 OS=Homo sapiens OX=9606 GN=GKN1 PE=1 SV=4
10	PDB:6e8nA	0.217	0.302	2.000E-2	185	0.034	0.049	6e8nA.pdb.gz
11	PDB:2w7qA	0.243	0.323	2.120E-2	192	0.052	0.073	2w7qA.pdb.gz
12	PDB:6jlaD	0.206	0.284	3.807E-2	188	0.041	0.059	6jlaD.pdb.gz	Structures of three ependymin-related proteins suggest their function as a hydrophobic molecule binder.
13	AFDB:Q69ZQ1	0.133	0.062	4.912E-2	716	0.086	0.032	Q69ZQ1.pdb.gz	MYORG_MOUSE Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
14	PDB:7jncA	0.094	0.091	1.158E-1	287	0.079	0.073	7jncA.pdb.gz
15	PDB:6fhmA	0.145	0.188	1.645E-1	193	0.060	0.083	6fhmA.pdb.gz
16	PDB:6sh3A	0.137	0.107	4.196E-1	376	0.090	0.064	6sh3A.pdb.gz	Structure of the Bcs1 AAA-ATPase suggests an airlock-like translocation mechanism for folded proteins.
17	PDB:7qe7A	0.131	0.031	5.622E-1	1648	0.071	0.012	7qe7A.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:2wxzA	0.110	0.073	5.961E-1	422	0.060	0.038	2wxzA.pdb.gz
19	PDB:6iyyA	0.148	0.132	7.105E-1	312	0.045	0.038	6iyyA.pdb.gz
20	PDB:3j16A	0.095	0.074	7.987E-1	386	0.060	0.041	3j16A.pdb.gz	Structural basis of highly conserved ribosome recycling in eukaryotes and archaea.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NQX7	0.0	558	267	1.000	1.000	ITM2C_HUMAN Integral membrane protein 2C OS=Homo sapiens OX=9606 GN=ITM2C PE=1 SV=1
2	Q91VK4	4.29e-168	467	269	0.936	0.929	ITM2C_MOUSE Integral membrane protein 2C OS=Mus musculus OX=10090 GN=Itm2c PE=1 SV=2
3	Q5XIE8	1.83e-74	229	266	0.446	0.447	ITM2B_RAT Integral membrane protein 2B OS=Rattus norvegicus OX=10116 GN=Itm2b PE=1 SV=1
4	O89051	1.12e-73	228	266	0.442	0.444	ITM2B_MOUSE Integral membrane protein 2B OS=Mus musculus OX=10090 GN=Itm2b PE=1 SV=1
5	A0A384MDP7	2.71e-73	226	266	0.449	0.451	A0A384MDP7_HUMAN Integral membrane protein 2 OS=Homo sapiens OX=9606 PE=2 SV=1
6	Q9Y287	2.71e-73	226	266	0.449	0.451	ITM2B_HUMAN Integral membrane protein 2B OS=Homo sapiens OX=9606 GN=ITM2B PE=1 SV=1
7	A0A3B3IUC0	2.18e-70	217	210	0.393	0.500	A0A3B3IUC0_HUMAN Integral membrane protein 2 OS=Homo sapiens OX=9606 GN=ITM2B PE=1 SV=1
8	O43736	1.25e-51	171	263	0.390	0.395	ITM2A_HUMAN Integral membrane protein 2A OS=Homo sapiens OX=9606 GN=ITM2A PE=1 SV=2
9	Q61500	9.64e-49	164	263	0.378	0.384	ITM2A_MOUSE Integral membrane protein 2A OS=Mus musculus OX=10090 GN=Itm2a PE=2 SV=2
10	Q2PDW1	9.90e-09	57.0	269	0.142	0.141	Q2PDW1_DROME Integral membrane protein 2 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3662 PE=1 SV=1
11	Q8T0C2	1.06e-08	57.0	269	0.142	0.141	Q8T0C2_DROME Integral membrane protein 2 OS=Drosophila melanogaster OX=7227 GN=CG3662 PE=2 SV=1
12	Q9VPT9	1.73e-08	56.6	319	0.142	0.119	Q9VPT9_DROME Integral membrane protein 2 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3662 PE=1 SV=1
13	P21841	0.024	37.4	193	0.127	0.176	PSPC_MOUSE Pulmonary surfactant-associated protein C OS=Mus musculus OX=10090 GN=Sftpc PE=1 SV=1
14	P11685	0.69	33.1	194	0.094	0.129	PSPC_RAT Pulmonary surfactant-associated protein C OS=Rattus norvegicus OX=10116 GN=Sftpc PE=2 SV=1
15	P10733	3.9	31.2	362	0.060	0.044	SEVE_DICDI Severin OS=Dictyostelium discoideum OX=44689 GN=sevA PE=1 SV=1
16	Q9LHB9	4.2	31.2	352	0.079	0.060	PER32_ARATH Peroxidase 32 OS=Arabidopsis thaliana OX=3702 GN=PER32 PE=1 SV=3
17	P55001	5.4	30.4	183	0.109	0.158	MFAP2_HUMAN Microfibrillar-associated protein 2 OS=Homo sapiens OX=9606 GN=MFAP2 PE=1 SV=1
18	Q8IM81	5.7	30.4	293	0.071	0.065	Q8IM81_PLAF7 Stevor OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1400700 PE=4 SV=1
19	Q8CGF1	6.1	30.8	1266	0.067	0.014	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
20	Q6Q473	9.8	30.0	924	0.071	0.021	CLA4A_MOUSE Calcium-activated chloride channel regulator 4A OS=Mus musculus OX=10090 GN=Clca4a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04089 BRICHOS	1.5e-17	74.9	BRICHOS domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358813	0.764	Dual specificity protein kinase TTK
2	9606.ENSP00000325917	0.720	Proprotein convertase subtilisin/kexin type 7
3	9606.ENSP00000316491	0.693	High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor
4	9606.ENSP00000321805	0.693	GTP-binding protein Rit2
5	9606.ENSP00000356058	0.689	Fas apoptotic inhibitory molecule 3
6	9606.ENSP00000304437	0.670	Protein very KIND
7	9606.ENSP00000275767	0.642	Transmembrane protein 140
8	9606.ENSP00000318585	0.621	Beta-secretase 1
9	9606.ENSP00000329292	0.621	Gastrokine-2
10	9606.ENSP00000367172	0.606	Gastrokine-1
11	9606.ENSP00000483552	0.593	Furin
12	9606.ENSP00000261486	0.573	Erythrocyte membrane protein band 4.1 like 4A
13	9606.ENSP00000448955	0.555	GAS2-like protein 3
14	9606.ENSP00000336994	0.539	Cleft lip and palate transmembrane protein 1
15	9606.ENSP00000294889	0.538	Uncharacterized protein C1orf115
16	9606.ENSP00000463092	0.524	Beta-microseminoprotein
17	9606.ENSP00000348842	0.502	Echinoderm microtubule-associated protein-like 6
18	9606.ENSP00000279024	0.501	Uncharacterized protein KIAA1755
19	9606.ENSP00000371434	0.501	Transcription factor RFX3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042277	0.998	peptide binding
GO:0005515	0.996	protein binding
GO:0001540	0.993	amyloid-beta binding
GO:0005524	0.982	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0009987	0.973	cellular process
GO:0048523	0.960	negative regulation of cellular process
GO:0032501	0.910	multicellular organismal process
GO:0048856	0.900	anatomical structure development
GO:0031344	0.861	regulation of cell projection organization
GO:0007275	0.804	multicellular organism development
GO:0048731	0.775	system development
GO:0007399	0.760	nervous system development
GO:0120035	0.709	regulation of plasma membrane bounded cell projection organization
GO:0051129	0.685	negative regulation of cellular component organization
GO:0031345	0.671	negative regulation of cell projection organization
GO:0010975	0.668	regulation of neuron projection development
GO:0010977	0.631	negative regulation of neuron projection development
GO:0048869	0.510	cellular developmental process
GO:0030154	0.477	cell differentiation
GO:0048518	0.337	positive regulation of biological process
GO:0023051	0.328	regulation of signaling
GO:0010646	0.328	regulation of cell communication
GO:0048583	0.325	regulation of response to stimulus
GO:0048522	0.319	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0016020	0.997	membrane
GO:0071944	0.995	cell periphery
GO:0005886	0.993	plasma membrane
GO:0005773	0.990	vacuole
GO:0005576	0.987	extracellular region
GO:0000323	0.954	lytic vacuole
GO:0031982	0.930	vesicle
GO:0005764	0.927	lysosome
GO:0005615	0.860	extracellular space
GO:1903561	0.537	extracellular vesicle
GO:0070062	0.534	extracellular exosome
GO:0005794	0.530	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]