StarFunc result for job id Q9NQZ6

User Input

>input (224 residues)
MADEQEIMCKLESIKEIRNKTLQMEKIKARLKAEFEALESEERHLKEYKQEMDLLLQEKM
AHVEELRLIHADINVMENTIKQSENDLNKLLESTRRLHDEYKPLKEHVDALRMTLGLQRL
PDLCEEEEKLSLDYFEKQKAEWQTEPQEPPIPESLAAAAAAAQQLQVARKQDTRQTATFR
QQPPPMKACLSCHQQIHRNAPICPLCKAKSRSRNPKKPKRKQDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A3Q2UBM5	0.777	0.703	2.346E-29	250	0.996	0.892	A0A3Q2UBM5.pdb.gz
2	AFDB:Q23664	0.471	0.420	9.272E-6	253	0.295	0.261	Q23664.pdb.gz	Q23664_CAEEL C4H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-23 PE=1 SV=4
3	AFDB:P60670	0.139	0.060	1.184E-1	608	0.058	0.021	P60670.pdb.gz	NPL4_MOUSE Nuclear protein localization protein 4 homolog OS=Mus musculus OX=10090 GN=Nploc4 PE=1 SV=3
4	AFDB:Q5FWF4	0.127	0.029	4.795E-1	1079	0.067	0.014	Q5FWF4.pdb.gz	ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens OX=9606 GN=ZRANB3 PE=1 SV=2
5	AFDB:Q8RXW0	0.141	0.098	5.125E-1	334	0.054	0.036	Q8RXW0.pdb.gz	RBL14_ARATH Rhomboid-like protein 14, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RBL14 PE=2 SV=1
6	AFDB:Q61510	0.207	0.100	6.689E-1	634	0.179	0.063	Q61510.pdb.gz	TRI25_MOUSE E3 ubiquitin/ISG15 ligase TRIM25 OS=Mus musculus OX=10090 GN=Trim25 PE=1 SV=2
7	AFDB:O13734	0.247	0.100	8.168E-1	647	0.129	0.045	O13734.pdb.gz	SGO2_SCHPO Shugoshin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgo2 PE=1 SV=1
8	PDB:7uhyD	0.096	0.075	8.814E-1	288	0.062	0.049	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
9	AFDB:Q15156	0.298	0.101	1.218	797	0.156	0.044	Q15156.pdb.gz	Q15156_HUMAN PML-RAR protein OS=Homo sapiens OX=9606 GN=PML-RAR PE=1 SV=1
10	AFDB:D4A9N5	0.280	0.116	1.487	643	0.116	0.040	D4A9N5.pdb.gz	D4A9N5_RAT Tripartite motif-containing 25 OS=Rattus norvegicus OX=10116 GN=Trim25 PE=1 SV=3
11	AFDB:Q924T7	0.137	0.035	1.487	1066	0.058	0.012	Q924T7.pdb.gz	RNF31_MOUSE E3 ubiquitin-protein ligase RNF31 OS=Mus musculus OX=10090 GN=Rnf31 PE=1 SV=2
12	PDB:7r7jB	0.128	0.054	2.095	574	0.040	0.016	7r7jB.pdb.gz	X-ray crystal structure of the Escherichia coli RadD DNA repair protein bound to ADP reveals a novel zinc ribbon domain.
13	PDB:7uhyA	0.097	0.033	2.095	771	0.040	0.012	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
14	PDB:7uhyC	0.092	0.041	2.095	578	0.089	0.035	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:2aqcA	0.111	0.325	2.734	63	0.049	0.175	2aqcA.pdb.gz	The Cbf5-Nop10 complex is a molecular bracket that organizes box H/ACA RNPs.
16	PDB:7bhpLm	0.079	0.305	2.922	52	0.040	0.173	7bhpLm.pdb.gz	Dynamic association of human Ebp1 with the ribosome.
17	PDB:3haxC	0.113	0.391	3.123	53	0.031	0.132	3haxC.pdb.gz	Structural mechanism of substrate RNA recruitment in H/ACA RNA-guided pseudouridine synthase.
18	PDB:4kfzB	0.092	0.122	3.338	148	0.049	0.074	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
19	PDB:6t9iF	0.087	0.144	4.657	111	0.080	0.162	6t9iF.pdb.gz
20	PDB:7d58L	0.102	0.406	4.657	47	0.049	0.234	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q68FG0	6.72e-163	450	224	1.000	1.000	ZC4H2_MOUSE Zinc finger C4H2 domain-containing protein OS=Mus musculus OX=10090 GN=Zc4h2 PE=2 SV=1
2	Q9NQZ6	6.72e-163	450	224	1.000	1.000	ZC4H2_HUMAN Zinc finger C4H2 domain-containing protein OS=Homo sapiens OX=9606 GN=ZC4H2 PE=1 SV=1
3	Q7T3I0	1.58e-143	401	224	0.942	0.942	ZC4H2_DANRE Zinc finger C4H2 domain-containing protein OS=Danio rerio OX=7955 GN=zc4h2 PE=2 SV=1
4	Q23664	1.19e-17	80.9	253	0.317	0.281	Q23664_CAEEL C4H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-23 PE=1 SV=4
5	Q9UBC2	0.23	35.0	864	0.129	0.034	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1
6	Q9VIQ9	0.53	33.9	2197	0.085	0.009	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
7	Q91713	0.98	32.7	941	0.067	0.016	CHRD_XENLA Chordin OS=Xenopus laevis OX=8355 GN=chrd PE=1 SV=1
8	F4JHE9	1.0	32.7	1185	0.161	0.030	F4JHE9_ARATH K+ efflux antiporter 2 OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=1
9	O65272	1.3	32.7	1174	0.161	0.031	KEA2_ARATH K(+) efflux antiporter 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=KEA2 PE=1 SV=2
10	Q6FVW6	2.5	31.6	692	0.174	0.056	Q6FVW6_CANGA Candida glabrata strain CBS138 chromosome D complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=KAR3 PE=1 SV=1
11	Q54JG6	3.5	31.2	2037	0.143	0.016	Q54JG6_DICDI Nucleoprotein TPR/MLP1 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288073 PE=4 SV=1
12	O43815	5.7	30.4	780	0.071	0.021	STRN_HUMAN Striatin OS=Homo sapiens OX=9606 GN=STRN PE=1 SV=4
13	P70278	5.8	30.4	393	0.103	0.059	STRA8_MOUSE Stimulated by retinoic acid gene 8 protein OS=Mus musculus OX=10090 GN=Stra8 PE=1 SV=1
14	O13786	6.1	30.4	536	0.143	0.060	PEP7_SCHPO Vacuolar segregation protein pep7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pep7 PE=3 SV=1
15	Q02224	6.2	30.4	2701	0.125	0.010	CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2
16	Q7TQ77	8.0	30.0	709	0.138	0.044	Q7TQ77_RAT Ac1288 OS=Rattus norvegicus OX=10116 GN=AABR07026291.1 PE=1 SV=1
17	Q13796	8.2	30.0	1616	0.161	0.022	SHRM2_HUMAN Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1
18	F1LPB4	8.3	30.0	3771	0.129	0.008	F1LPB4_RAT A-kinase anchoring protein 9 OS=Rattus norvegicus OX=10116 GN=Akap9 PE=1 SV=2
19	Q387Z4	8.7	30.0	695	0.080	0.026	Q387Z4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1340 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10046 BLOC1_2	5.1e+02	12.4	Biogenesis of lysosome-related organelles complex-1 subunit 2
2	PF09496 CENP-O	1.6e+02	13.7	Cenp-O kinetochore centromere component
3	PF12773 DZR	22	16.4	Double zinc ribbon
4	PF18912 DZR_2	3.2e+02	12.6	Double zinc ribbon domain
5	PF03908 Sec20	29	16.0	Sec20
6	PF04136 Sec34	6.6e+02	11.6	Sec34-like family
7	PF13920 zf-C3HC4_3	2e+02	13.3	Zinc finger, C3HC4 type (RING finger)
8	PF10146 zf-C4H2	4.9e-72	254.9	Zinc finger-containing protein
9	PF03854 zf-P11	2.9e+02	12.5	P-11 zinc finger
10	PF14570 zf-RING_4	4.6e+02	12.0	RING/Ubox like zinc-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000024353

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000031935	0.747	Ring finger protein 220
2	9612.ENSCAFP00000005456	0.634	Neuroblastoma amplified sequence
3	9612.ENSCAFP00000022437	0.599	Zinc finger protein 182
4	9612.ENSCAFP00000022149	0.573	Uncharacterized protein
5	9612.ENSCAFP00000003592	0.564	N-acetylneuraminic acid synthase
6	9612.ENSCAFP00000027601	0.541	Palmitoyltransferase
7	9612.ENSCAFP00000002647	0.538	Regulatory factor X, 4 (influences HLA class II expression)
8	9612.ENSCAFP00000017855	0.530	ZFP57 zinc finger protein
9	9612.ENSCAFP00000021924	0.529	RNA binding motif protein 10
10	9612.ENSCAFP00000015816	0.520	Immunoglobulin mu binding protein 2
11	9612.ENSCAFP00000038304	0.520	Zinc finger protein 597

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0050794	0.985	regulation of cellular process
GO:0032501	0.928	multicellular organismal process
GO:0032502	0.893	developmental process
GO:0048731	0.884	system development
GO:0071704	0.869	organic substance metabolic process
GO:0019222	0.869	regulation of metabolic process
GO:0007399	0.853	nervous system development
GO:0051171	0.832	regulation of nitrogen compound metabolic process
GO:0080090	0.831	regulation of primary metabolic process
GO:0051101	0.827	regulation of DNA binding
GO:0060255	0.826	regulation of macromolecule metabolic process
GO:0031323	0.807	regulation of cellular metabolic process
GO:0048869	0.804	cellular developmental process
GO:0044238	0.802	primary metabolic process
GO:0010468	0.792	regulation of gene expression
GO:0043170	0.787	macromolecule metabolic process
GO:0019219	0.785	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.780	regulation of RNA metabolic process
GO:2000677	0.779	regulation of transcription regulatory region DNA binding
GO:2001141	0.771	regulation of RNA biosynthetic process
GO:0030154	0.766	cell differentiation
GO:0048518	0.765	positive regulation of biological process
GO:0006355	0.754	regulation of DNA-templated transcription
GO:0048522	0.731	positive regulation of cellular process
GO:0048513	0.707	animal organ development
GO:0048699	0.681	generation of neurons
GO:0045666	0.674	positive regulation of neuron differentiation
GO:0006807	0.672	nitrogen compound metabolic process
GO:0021510	0.597	spinal cord development
GO:0030182	0.576	neuron differentiation
GO:0043412	0.556	macromolecule modification
GO:0032446	0.508	protein modification by small protein conjugation
GO:0006513	0.367	protein monoubiquitination
GO:0051091	0.344	positive regulation of DNA-binding transcription factor activity
GO:0021515	0.323	cell differentiation in spinal cord
GO:0021953	0.307	central nervous system neuron differentiation
GO:0021517	0.300	ventral spinal cord development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0016020	0.978	membrane
GO:0032991	0.972	protein-containing complex
GO:0005737	0.871	cytoplasm
GO:0071944	0.733	cell periphery
GO:0005886	0.706	plasma membrane
GO:0031981	0.475	nuclear lumen
GO:0005654	0.412	nucleoplasm
GO:0030054	0.370	cell junction
GO:0005829	0.368	cytosol
GO:0045202	0.353	synapse
GO:0098794	0.334	postsynapse
GO:0012505	0.326	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]