StarFunc result for job id Q9NR09

User Input

>input (1400 residues)
MVTGGGAAPPGTVTEPLPSVIVLSAGRKMAAAAAAASGPGCSSAAGAGAAGVSEWLVLRD
GCMHCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKCQYI
SAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSACLEK
VDISSTEGYDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVNELK
KINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRSLMYSEANRRETFTSWPHVG
YRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPFVKG
EHTQNVPLSVTLATSPAQFPCTDGTDRISCFGSGSCPHFLAAATKRGKICIWDVSKLMKV
HLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLLEDS
DSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEELGA
NPCLTNSKSEKTKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRTQGE
SISEQGSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSLHDD
GFTVPQIIEMELDSQEQLLLQDPPVTYIQQFADAAANLTSPDSEKWNSVFPKPGTLVQCL
RLPKFAEEENLCIDSITPCADGIHLLVGLRTCPVESLSAINQVEALNNLNKLNSALCNRR
KGELESNLAVVNGANISVIQHESPADVQTPLIIQPEQRNVSGGYLVLYKMNYATRIVTLE
EEPIKIQHIKDPQDTITSLILLPPDILDNREDDCEEPIEDMQLTSKNGFEREKTSDISTL
GHLVITTQGGYVKILDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCACTKGGE
LHFLQIGGTCDDIDEADILVDGSLSKGIEPSSEGSKPLSNPSSPGISGVDLLVDQPFTLE
ILTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRTWKLQ
TDSNSWDEHVFELVLPKACMVGHVDFKFVLNSNITNIPQIQVTLLKNKAPGLGKVNALNI
EVEQNGKPSLVDLNEEMQHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSGHAGM
LTLTSPKLVKGMAGGKYRSFLIHVKAVNERGTEEICNGGMRPVVRLPSLKHQSNKGYSLA
SLLAKVAAGKEKSSNVKNENTSGTRKSENLRGCDLLQEVSVTIRRFKKTSISKERVQRCA
MLQFSEFHEKLVNTLCRKTDDGQITEHAQSLVLDTLCWLAGVHSNGPGSSKEGNENLLSK
TRKFLSDIVRVCFFEAGRSI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8MS47	0.421	0.504	3.000E-51	1151	0.212	0.258	Q8MS47.pdb.gz	Q8MS47_DROME RE07981p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Bruce PE=2 SV=1
2	PDB:6n8sA	0.090	0.124	2.746E-5	834	0.069	0.116	6n8sA.pdb.gz
3	PDB:1m4mA	0.059	0.648	1.466E-4	112	0.024	0.304	1m4mA.pdb.gz	CRYSTAL STRUCTURE AND MUTAGENIC ANALYSIS OF THE INHIBITOR-OF-APOPTOSIS PROTEIN SURVIVIN
4	PDB:3uedC	0.051	0.492	9.072E-4	139	0.021	0.216	3uedC.pdb.gz	Molecular basis for phosphospecific recognition of histone H3 tails by Survivin paralogues at inner centromeres.
5	PDB:7d5sBE	0.080	0.118	1.485E-3	865	0.060	0.097	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
6	PDB:7bt6x	0.169	0.428	1.899E-3	488	0.036	0.102	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
7	PDB:5wlcLV	0.079	0.279	2.313E-3	362	0.020	0.077	5wlcLV.pdb.gz	The complete structure of the small-subunit processome.
8	PDB:3zwlD	0.073	0.211	2.430E-3	352	0.024	0.097	3zwlD.pdb.gz
9	PDB:7mq8LS	0.074	0.178	2.430E-3	453	0.019	0.060	7mq8LS.pdb.gz	Nucleolar maturation of the human small subunit processome.
10	PDB:7mq8LR	0.108	0.178	3.265E-3	773	0.043	0.078	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:4v6wAg	0.065	0.238	3.430E-3	318	0.024	0.104	4v6wAg.pdb.gz	Structures of the human and Drosophila 80S ribosome.
12	AFDB:D6W4T8	0.062	0.067	6.814E-2	1266	0.074	0.081	D6W4T8.pdb.gz	D6W4T8_DROME Coronin OS=Drosophila melanogaster OX=7227 GN=pod1 PE=1 SV=1
13	AFDB:A0A1P8AW69	0.073	0.094	1.062E-1	1019	0.093	0.128	A0A1P8AW69.pdb.gz	KTN81_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.1 OS=Arabidopsis thaliana OX=3702 GN=KTN80.1 PE=1 SV=1
14	AFDB:Q8IUX7	0.044	0.051	4.014E-1	1158	0.049	0.059	Q8IUX7.pdb.gz	AEBP1_HUMAN Adipocyte enhancer-binding protein 1 OS=Homo sapiens OX=9606 GN=AEBP1 PE=1 SV=1
15	AFDB:Q17RD7	0.032	0.047	4.217E-1	645	0.062	0.135	Q17RD7.pdb.gz	SYT16_HUMAN Synaptotagmin-16 OS=Homo sapiens OX=9606 GN=SYT16 PE=1 SV=2
16	AFDB:Q9VFP2	0.034	0.047	5.667E-1	829	0.056	0.094	Q9VFP2.pdb.gz	RDX_DROME Protein roadkill OS=Drosophila melanogaster OX=7227 GN=rdx PE=1 SV=2
17	AFDB:Q32MH5	0.049	0.058	7.250E-1	1076	0.079	0.103	Q32MH5.pdb.gz	ATOSA_HUMAN Atos homolog protein A OS=Homo sapiens OX=9606 GN=ATOSA PE=1 SV=2
18	AFDB:Q54DS6	0.047	0.037	8.001E-1	2221	0.110	0.069	Q54DS6.pdb.gz	Q54DS6_DICDI SH3 domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=docA PE=3 SV=1
19	AFDB:M9PHU0	0.052	0.039	9.275E-1	2263	0.070	0.043	M9PHU0.pdb.gz	M9PHU0_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=CG12432 PE=1 SV=1
20	AFDB:P22682	0.055	0.070	1.130	913	0.074	0.113	P22682.pdb.gz	CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus OX=10090 GN=Cbl PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O88738	0.0	2625	4882	0.949	0.272	BIRC6_MOUSE Baculoviral IAP repeat-containing protein 6 OS=Mus musculus OX=10090 GN=Birc6 PE=1 SV=2
2	Q9NR09	0.0	2905	4857	0.999	0.288	BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=3
3	Q8MS47	3.23e-84	303	1151	0.106	0.129	Q8MS47_DROME RE07981p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Bruce PE=2 SV=1
4	A0A0B4KG50	3.47e-82	301	4976	0.106	0.030	A0A0B4KG50_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform B OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
5	A0A0B4KH36	4.40e-82	301	4852	0.106	0.031	A0A0B4KH36_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform C OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
6	A0A0B4KGR9	4.60e-82	301	4875	0.106	0.031	A0A0B4KGR9_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform D OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
7	Q9VH01	4.72e-82	301	4876	0.106	0.031	Q9VH01_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform A OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=3
8	A0A0B4KFQ0	4.80e-82	301	4865	0.106	0.031	A0A0B4KFQ0_DROME BIR repeat containing ubiquitin-conjugating enzyme, isoform E OS=Drosophila melanogaster OX=7227 GN=Bruce PE=1 SV=1
9	Q90WU8	4.78e-17	80.9	128	0.026	0.289	Q90WU8_DANRE Baculoviral IAP repeat-containing 5b OS=Danio rerio OX=7955 GN=bir5b PE=2 SV=1
10	Q90WU9	1.22e-15	77.4	142	0.026	0.254	Q90WU9_DANRE Baculoviral IAP repeat-containing 5a OS=Danio rerio OX=7955 GN=bir5a PE=1 SV=1
11	Q8JGN5	2.91e-14	73.9	160	0.025	0.219	BI51A_XENLA Baculoviral IAP repeat-containing protein 5.1-A OS=Xenopus laevis OX=8355 GN=birc5.1-a PE=1 SV=1
12	Q9VEM2	1.14e-13	72.0	153	0.025	0.229	Q9VEM2_DROME Deterin OS=Drosophila melanogaster OX=7227 GN=Det PE=1 SV=1
13	Q9JHY7	2.35e-13	70.9	142	0.024	0.232	BIRC5_RAT Baculoviral IAP repeat-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Birc5 PE=2 SV=1
14	Q804H7	6.19e-13	70.1	157	0.023	0.204	BI52B_XENLA Baculoviral IAP repeat-containing protein 5.2-B OS=Xenopus laevis OX=8355 GN=birc5.2-b PE=1 SV=2
15	Q50L39	6.31e-13	70.1	157	0.023	0.204	BI52A_XENLA Baculoviral IAP repeat-containing protein 5.2-A OS=Xenopus laevis OX=8355 GN=birc5.2-a PE=1 SV=1
16	O70201	1.10e-12	68.9	140	0.023	0.229	BIRC5_MOUSE Baculoviral IAP repeat-containing protein 5 OS=Mus musculus OX=10090 GN=Birc5 PE=1 SV=1
17	P98170	2.61e-12	73.6	497	0.032	0.091	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
18	E3SCZ8	6.33e-12	67.0	142	0.023	0.225	BIRC5_CAVPO Baculoviral IAP repeat-containing protein 5 OS=Cavia porcellus OX=10141 GN=BIRC5 PE=1 SV=1
19	E7CU85	1.27e-11	65.9	142	0.021	0.211	E7CU85_HUMAN Baculoviral IAP repeat-containing 5 OS=Homo sapiens OX=9606 GN=BIRC5 PE=1 SV=1
20	O15392	1.27e-11	65.9	142	0.021	0.211	BIRC5_HUMAN Baculoviral IAP repeat-containing protein 5 OS=Homo sapiens OX=9606 GN=BIRC5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00653 BIR	7.3e-18	76.3	Inhibitor of Apoptosis domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393596

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398495	0.971	Diablo homolog, mitochondrial
2	9606.ENSP00000342755	0.964	E3 ubiquitin-protein ligase NRDP1
3	9606.ENSP00000258080	0.924	Serine protease HTRA2, mitochondrial
4	9606.ENSP00000379721	0.881	Ubiquitin carboxyl-terminal hydrolase 8
5	9606.ENSP00000330237	0.855	Caspase-9
6	9606.ENSP00000311032	0.853	Caspase-3
7	9606.ENSP00000381577	0.824	Ubiquitin carboxyl-terminal hydrolase 34
8	9606.ENSP00000217169	0.820	Baculoviral IAP repeat-containing protein 7
9	9606.ENSP00000364403	0.806	E3 ubiquitin-protein ligase UBR4
10	9606.ENSP00000358327	0.740	Caspase-7
11	9606.ENSP00000260363	0.738	Kinesin-like protein KIF23
12	9606.ENSP00000219905	0.691	MAX gene-associated protein
13	9606.ENSP00000275034	0.688	PH-interacting protein
14	9606.ENSP00000402515	0.686	Serine/threonine-protein kinase SMG1
15	9606.ENSP00000351015	0.683	Neurofibromin
16	9606.ENSP00000330753	0.680	Bromodomain and WD repeat-containing protein 1
17	9606.ENSP00000293303	0.679	Kelch-like protein 10
18	9606.ENSP00000330601	0.665	HHIP-like protein 1
19	9606.ENSP00000458075	0.661	BOLA2-SMG1P6 readthrough
20	9606.ENSP00000313454	0.653	Ubiquitin-like modifier-activating enzyme 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0061631	0.991	ubiquitin conjugating enzyme activity
GO:0030414	0.827	peptidase inhibitor activity
GO:0004869	0.765	cysteine-type endopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0016567	0.979	protein ubiquitination
GO:0042981	0.972	regulation of apoptotic process
GO:0043069	0.970	negative regulation of programmed cell death
GO:0043066	0.938	negative regulation of apoptotic process
GO:0009987	0.936	cellular process
GO:0042127	0.805	regulation of cell population proliferation
GO:0044237	0.656	cellular metabolic process
GO:0051302	0.467	regulation of cell division
GO:0048583	0.318	regulation of response to stimulus
GO:0023051	0.316	regulation of signaling
GO:0010646	0.316	regulation of cell communication
GO:0009966	0.308	regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005622	0.969	intracellular anatomical structure
GO:0043232	0.903	intracellular non-membrane-bounded organelle
GO:0012505	0.824	endomembrane system
GO:0005829	0.770	cytosol
GO:0043227	0.760	membrane-bounded organelle
GO:0043231	0.751	intracellular membrane-bounded organelle
GO:0005856	0.566	cytoskeleton
GO:0015630	0.535	microtubule cytoskeleton
GO:0031982	0.377	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.
EC:2.3.2.23	0.991	E2 ubiquitin-conjugating enzyme.

[back to server]