StarFunc result for job id Q9NR16

User Input

>input (1453 residues)
MMLPQNSWHIDFGRCCCHQNLFSAVVTCILLLNSCFLISSFNGTDLELRLVNGDGPCSGT
VEVKFQGQWGTVCDDGWNTTASTVVCKQLGCPFSFAMFRFGQAVTRHGKIWLDDVSCYGN
ESALWECQHREWGSHNCYHGEDVGVNCYGEANLGLRLVDGNNSCSGRVEVKFQERWGTIC
DDGWNLNTAAVVCRQLGCPSSFISSGVVNSPAVLRPIWLDDILCQGNELALWNCRHRGWG
NHDCSHNEDVTLTCYDSSDLELRLVGGTNRCMGRVELKIQGRWGTVCHHKWNNAAADVVC
KQLGCGTALHFAGLPHLQSGSDVVWLDGVSCSGNESFLWDCRHSGTVNFDCLHQNDVSVI
CSDGADLELRLADGSNNCSGRVEVRIHEQWWTICDQNWKNEQALVVCKQLGCPFSVFGSR
RAKPSNEARDIWINSISCTGNESALWDCTYDGKAKRTCFRRSDAGVICSDKADLDLRLVG
AHSPCYGRLEVKYQGEWGTVCHDRWSTRNAAVVCKQLGCGKPLHVFGMTYFKEASGPIWL
DDVSCIGNESNIWDCEHSGWGKHNCVHREDVIVTCSGDATWGLRLVGGSNRCSGRLEVYF
QGRWGTVCDDGWNSKAAAVVCSQLDCPSSIIGMGLGNASTGYGKIWLDDVSCDGDESDLW
SCRNSGWGNNDCSHSEDVGVICSDASDMELRLVGGSSRCAGKVEVNVQGAVGILCANGWG
MNIAEVVCRQLECGSAIRVSREPHFTERTLHILMSNSGCTGGEASLWDCIRWEWKQTACH
LNMEASLICSAHRQPRLVGADMPCSGRVEVKHADTWRSVCDSDFSLHAANVLCRELNCGD
AISLSVGDHFGKGNGLTWAEKFQCEGSETHLALCPIVQHPEDTCIHSREVGVVCSRYTDV
RLVNGKSQCDGQVEINVLGHWGSLCDTHWDPEDARVLCRQLSCGTALSTTGGKYIGERSV
RVWGHRFHCLGNESLLDNCQMTVLGAPPCIHGNTVSVICTGSLTQPLFPCLANVSDPYLS
AVPEGSALICLEDKRLRLVDGDSRCAGRVEIYHDGFWGTICDDGWDLSDAHVVCQKLGCG
VAFNATVSAHFGEGSGPIWLDDLNCTGMESHLWQCPSRGWGQHDCRHKEDAGVICSEFTA
LRLYSETETESCAGRLEVFYNGTWGSVGRRNITTAIAGIVCRQLGCGENGVVSLAPLSKT
GSGFMWVDDIQCPKTHISIWQCLSAPWERRISSPAEETWITCEDRIRVRGGDTECSGRVE
IWHAGSWGTVCDDSWDLAEAEVVCQQLGCGSALAALRDASFGQGTGTIWLDDMRCKGNES
FLWDCHAKPWGQSDCGHKEDAGVRCSGQSLKSLNASSGHLALILSSIFGLLLLVLFILFL
TWCRVQKQKHLPLRVSTRRRGSLEENLFHEMETCLKREDPHGTRTSDDTPNHGCEDASDT
SLLGVLPASEATK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JVY2	0.435	0.549	0.000	1111	0.399	0.522	A0A0G2JVY2.pdb.gz	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
2	AFDB:Q86VB7	0.337	0.409	0.000	1156	0.417	0.524	Q86VB7.pdb.gz	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
3	AFDB:Q9UGM3	0.170	0.118	0.000	2413	0.420	0.253	Q9UGM3.pdb.gz	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
4	AFDB:Q60997	0.108	0.082	2.555E-88	2085	0.310	0.216	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
5	AFDB:B3F5L4	0.147	0.188	3.284E-88	1112	0.272	0.355	B3F5L4.pdb.gz	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
6	AFDB:A0A1B0GSB0	0.148	0.207	1.233E-85	991	0.264	0.387	A0A1B0GSB0.pdb.gz	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
7	AFDB:B3F5L5	0.147	0.206	2.512E-84	996	0.251	0.366	B3F5L5.pdb.gz	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
8	AFDB:Q4G0T1	0.139	0.188	3.571E-78	1027	0.253	0.357	Q4G0T1.pdb.gz	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
9	AFDB:Q8BV57	0.134	0.141	7.912E-55	1371	0.197	0.209	Q8BV57.pdb.gz	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
10	AFDB:A1L4H1	0.136	0.127	4.828E-54	1573	0.212	0.196	A1L4H1.pdb.gz	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
11	PDB:2xrcC	0.067	0.201	1.067E-4	454	0.021	0.066	2xrcC.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
12	PDB:2xrcB	0.066	0.185	3.064E-4	485	0.021	0.064	2xrcB.pdb.gz	Structural Basis for Complement Factor I Control and its Disease-Associated Sequence Polymorphisms.
13	PDB:6b0tA	0.060	0.108	7.019E-1	487	0.030	0.088	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
14	PDB:7t3pA	0.041	0.034	2.016	2066	0.025	0.017	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
15	PDB:1vclA	0.041	0.095	2.344	432	0.013	0.044	1vclA.pdb.gz	Crystal Structure of the Hemolytic Lectin CEL-III Isolated from the Marine Invertebrate Cucumaria echinata: IMPLICATIONS OF DOMAIN STRUCTURE FOR ITS MEMBRANE PORE-FORMATION MECHANISM
16	PDB:2jz4A	0.037	0.100	2.865	299	0.024	0.117	2jz4A.pdb.gz
17	PDB:6cm9M	0.045	0.102	3.168	415	0.016	0.055	6cm9M.pdb.gz	HIV-1 Nefs Are Cargo-Sensitive AP-1 Trimerization Switches in Tetherin Downregulation.
18	PDB:4n2iA	0.019	0.035	3.503	662	0.006	0.014	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
19	PDB:5x22D	0.032	0.032	3.503	1438	0.015	0.015	5x22D.pdb.gz	Antibacterial Nucleoside-Analog Inhibitor of Bacterial RNA Polymerase.
20	PDB:4n20A	0.019	0.035	3.873	639	0.008	0.017	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVY2	0.0	1156	1151	0.398	0.503	A0A0G2JVY2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=2
2	A0A1B0GSB0	0.0	617	991	0.257	0.377	A0A1B0GSB0_MOUSE Scavenger receptor family member expressed on T cells 1 OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
3	A0A8I5ZQF0	0.0	1154	1109	0.392	0.513	A0A8I5ZQF0_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=1 SV=1
4	B3F5L4	0.0	589	1112	0.269	0.352	B3F5L4_MOUSE SCART2 splice variant A OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
5	B3F5L5	0.0	600	996	0.247	0.360	B3F5L5_MOUSE SCART2 splice variant B OS=Mus musculus OX=10090 GN=Scart2 PE=1 SV=1
6	D3Z9U2	0.0	1154	1110	0.392	0.513	D3Z9U2_RAT CD163 molecule OS=Rattus norvegicus OX=10116 GN=Cd163 PE=4 SV=2
7	Q86VB7	0.0	1238	1156	0.418	0.526	C163A_HUMAN Scavenger receptor cysteine-rich type 1 protein M130 OS=Homo sapiens OX=9606 GN=CD163 PE=1 SV=2
8	Q8BIC8	0.0	611	991	0.257	0.376	Q8BIC8_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart1 PE=2 SV=1
9	Q8CGY7	0.0	619	989	0.259	0.381	Q8CGY7_MOUSE Scavenger receptor cysteine-rich type 1 protein CD163c-alpha OS=Mus musculus OX=10090 GN=Scart1 PE=1 SV=1
10	Q9UGM3	0.0	644	2413	0.295	0.177	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
11	Q60997	4.18e-163	543	2085	0.233	0.163	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
12	Q4G0T1	2.16e-149	483	1027	0.233	0.330	SRCRM_HUMAN Scavenger receptor cysteine-rich domain-containing protein SCART1 OS=Homo sapiens OX=9606 GN=SCART1 PE=1 SV=2
13	P56730	1.43e-78	281	875	0.123	0.203	NETR_HUMAN Neurotrypsin OS=Homo sapiens OX=9606 GN=PRSS12 PE=2 SV=2
14	A1L4H1	1.19e-77	286	1573	0.142	0.132	SRCRL_HUMAN Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3
15	Q8BV57	3.08e-77	284	1371	0.140	0.149	SRCRL_MOUSE Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Mus musculus OX=10090 GN=Ssc5d PE=1 SV=1
16	Q8C9T4	1.03e-72	252	446	0.105	0.343	Q8C9T4_MOUSE SRCR domain-containing protein OS=Mus musculus OX=10090 GN=Scart2 PE=2 SV=1
17	O43866	1.35e-70	243	347	0.096	0.403	CD5L_HUMAN CD5 antigen-like OS=Homo sapiens OX=9606 GN=CD5L PE=1 SV=1
18	O08762	3.82e-67	245	761	0.089	0.171	NETR_MOUSE Neurotrypsin OS=Mus musculus OX=10090 GN=Prss12 PE=1 SV=1
19	Q8CIZ5	9.83e-66	248	1418	0.116	0.119	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
20	Q9QWK4	1.51e-65	228	352	0.089	0.369	CD5L_MOUSE CD5 antigen-like OS=Mus musculus OX=10090 GN=Cd5l PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17656 ChapFlgA_N	4.6e+02	12.4	FlgA N-terminal domain
2	PF09272 Hepsin-SRCR	0.011	27.8	Hepsin, SRCR domain
3	PF00530 SRCR	0	1036.4	Scavenger receptor cysteine-rich domain
4	PF15494 SRCR_2	6.1e-34	128.0	Scavenger receptor cysteine-rich domain
5	PF15164 WBS28	5.7e+02	11.2	Williams-Beuren syndrome chromosomal region 28 protein homologue

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000393474

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370767	0.589	Pancreatic secretory granule membrane major glycoprotein GP2
2	9606.ENSP00000464275	0.559	Protein Njmu-R1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097110	0.999	scaffold protein binding
GO:0005044	0.996	scavenger receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.805	multicellular organismal process
GO:0048856	0.707	anatomical structure development
GO:0007275	0.539	multicellular organism development
GO:0007568	0.529	aging
GO:0010259	0.514	multicellular organism aging
GO:0050789	0.489	regulation of biological process
GO:0009987	0.472	cellular process
GO:0050794	0.423	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.998	cellular anatomical entity
GO:0009986	0.984	cell surface
GO:0071944	0.976	cell periphery
GO:0016020	0.975	membrane
GO:0005886	0.969	plasma membrane
GO:0031982	0.897	vesicle
GO:0005622	0.779	intracellular anatomical structure
GO:0043231	0.690	intracellular membrane-bounded organelle
GO:0005737	0.624	cytoplasm
GO:0031410	0.473	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]