StarFunc result for job id Q9NR22

User Input

>input (394 residues)
MGMKHSSRCLLLRRKMAENAAESTEVNSPPSQPPQPVVPAKPVQCVHHVSTQPSCPGRGK
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGS
GTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVD
IIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWE
NVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQR
NDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISM
KPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NR22	1.000	1.000	3.927E-84	394	1.000	1.000	Q9NR22.pdb.gz	ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens OX=9606 GN=PRMT8 PE=1 SV=2
2	AFDB:Q5RGQ2	0.810	0.763	4.488E-73	419	0.843	0.792	Q5RGQ2.pdb.gz	ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio OX=7955 GN=prmt8b PE=2 SV=2
3	AFDB:Q99873	0.838	0.889	5.122E-67	371	0.706	0.749	Q99873.pdb.gz	ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3
4	AFDB:Q803D9	0.810	0.844	1.176E-66	378	0.716	0.746	Q803D9.pdb.gz
5	PDB:6nt2A	0.810	0.966	9.975E-65	330	0.695	0.830	6nt2A.pdb.gz	Anti-tumor Activity of the Type I PRMT Inhibitor, GSK3368715, Synergizes with PRMT5 Inhibition through MTAP Loss.
6	AFDB:Q9VGW7	0.825	0.864	7.148E-64	376	0.584	0.612	Q9VGW7.pdb.gz	Q9VGW7_DROME Arginine methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Art1 PE=1 SV=1
7	AFDB:Q9U2X0	0.817	0.924	2.033E-60	348	0.571	0.647	Q9U2X0.pdb.gz	ANM1_CAEEL Protein arginine N-methyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=prmt-1 PE=1 SV=1
8	AFDB:Q9SU94	0.821	0.829	2.837E-57	390	0.490	0.495	Q9SU94.pdb.gz	ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana OX=3702 GN=PRMT11 PE=1 SV=1
9	AFDB:C8V494	0.804	0.918	5.020E-54	345	0.464	0.530	C8V494.pdb.gz	C8V494_EMENI RmtA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10526 PE=4 SV=1
10	AFDB:Q9URX7	0.819	0.947	8.169E-53	340	0.464	0.538	Q9URX7.pdb.gz	ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2
11	AFDB:Q8ILK1	0.823	0.809	4.966E-50	401	0.383	0.377	Q8ILK1.pdb.gz	Q8ILK1_PLAF7 Protein arginine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1426200 PE=4 SV=1
12	PDB:6dnzA	0.787	0.974	2.384E-46	317	0.409	0.508	6dnzA.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
13	PDB:1g6q1	0.777	0.930	1.077E-43	328	0.406	0.488	1g6q1.pdb.gz
14	PDB:4y2hB	0.732	0.816	5.291E-39	352	0.294	0.330	4y2hB.pdb.gz	Aryl Pyrazoles as Potent Inhibitors of Arginine Methyltransferases: Identification of the First PRMT6 Tool Compound.
15	PDB:3r0qG	0.736	0.819	8.610E-38	353	0.274	0.306	3r0qG.pdb.gz	Crystal structure of the plant epigenetic protein arginine methyltransferase 10.
16	PDB:6dnzB	0.709	0.864	4.184E-29	319	0.213	0.263	6dnzB.pdb.gz	Structural Basis of Protein Arginine Methyltransferase Activation by a Catalytically Dead Homolog (Prozyme).
17	PDB:4lwpB	0.614	0.702	1.491E-26	342	0.251	0.289	4lwpB.pdb.gz	Crystal Structure of Arginine Methyltransferase 6 from Trypanosoma brucei
18	PDB:4c4aA	0.574	0.368	3.906E-20	641	0.168	0.103	4c4aA.pdb.gz	Structural Insight Into Arginine Methylation by the Mouse Protein Arginine Methyltransferase 7: A Zinc Finger Freezes the Mimic of the Dimeric State Into a Single Active Site.
19	PDB:4g56A	0.588	0.389	1.828E-19	617	0.150	0.096	4g56A.pdb.gz	Structure of the arginine methyltransferase PRMT5-MEP50 reveals a mechanism for substrate specificity
20	PDB:7bo7AAA	0.612	0.399	8.157E-18	625	0.147	0.093	7bo7AAA.pdb.gz	CRYSTAL STRUCTURE OF THE HUMAN PRMT5:MEP50 COMPLEX with JNJB44355437

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1R3J9	0.0	599	348	0.698	0.790	F1R3J9_DANRE Protein arginine N-methyltransferase 1 OS=Danio rerio OX=7955 GN=fb39h07 PE=1 SV=1
2	Q5RGQ2	0.0	683	419	0.838	0.788	ANM8B_DANRE Protein arginine N-methyltransferase 8-B OS=Danio rerio OX=7955 GN=prmt8b PE=2 SV=2
3	Q63009	0.0	607	353	0.711	0.793	ANM1_RAT Protein arginine N-methyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Prmt1 PE=1 SV=1
4	Q6VRB0	0.0	603	351	0.695	0.781	ANM1B_XENLA Protein arginine N-methyltransferase 1-B OS=Xenopus laevis OX=8355 GN=prmt1-b PE=1 SV=1
5	Q8AV13	0.0	601	369	0.701	0.748	ANM1A_XENLA Protein arginine N-methyltransferase 1-A OS=Xenopus laevis OX=8355 GN=prmt1-a PE=1 SV=1
6	Q99873	0.0	608	371	0.713	0.757	ANM1_HUMAN Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=3
7	Q9JIF0	0.0	606	371	0.713	0.757	ANM1_MOUSE Protein arginine N-methyltransferase 1 OS=Mus musculus OX=10090 GN=Prmt1 PE=1 SV=1
8	Q9NR22	0.0	829	394	1.000	1.000	ANM8_HUMAN Protein arginine N-methyltransferase 8 OS=Homo sapiens OX=9606 GN=PRMT8 PE=1 SV=2
9	Q9VGW7	0.0	512	376	0.574	0.601	Q9VGW7_DROME Arginine methyltransferase 1 OS=Drosophila melanogaster OX=7227 GN=Art1 PE=1 SV=1
10	Q9U2X0	4.99e-170	480	348	0.566	0.641	ANM1_CAEEL Protein arginine N-methyltransferase 1 OS=Caenorhabditis elegans OX=6239 GN=prmt-1 PE=1 SV=1
11	Q9SU94	1.21e-144	417	390	0.480	0.485	ANM11_ARATH Protein arginine N-methyltransferase 1.1 OS=Arabidopsis thaliana OX=3702 GN=PRMT11 PE=1 SV=1
12	C8V494	5.19e-129	376	345	0.447	0.510	C8V494_EMENI RmtA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10526 PE=4 SV=1
13	Q9URX7	8.68e-128	373	340	0.454	0.526	ANM1_SCHPO Protein arginine N-methyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rmt1 PE=1 SV=2
14	H0YDE4	2.32e-121	353	238	0.421	0.697	H0YDE4_HUMAN Protein arginine methyltransferase 1 (Fragment) OS=Homo sapiens OX=9606 GN=PRMT1 PE=1 SV=1
15	Q5A943	1.54e-113	337	339	0.416	0.484	Q5A943_CANAL Protein-arginine omega-N methyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HMT1 PE=4 SV=1
16	Q4GYA9	4.79e-109	325	345	0.421	0.481	Q4GYA9_TRYB2 Arginine N-methyltransferase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4690 PE=1 SV=1
17	P38074	4.90e-109	325	348	0.393	0.445	HMT1_YEAST Protein arginine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HMT1 PE=1 SV=1
18	O60678	1.11e-104	320	531	0.386	0.286	ANM3_HUMAN Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4
19	Q8ILK1	2.35e-103	313	401	0.383	0.377	Q8ILK1_PLAF7 Protein arginine N-methyltransferase 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1426200 PE=4 SV=1
20	O70467	6.01e-100	308	528	0.378	0.282	ANM3_RAT Protein arginine N-methyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Prmt3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08123 DOT1	2.5	19.1	Histone methylation protein DOT1
2	PF02527 GidB	6.3e+02	11.1	rRNA small subunit methyltransferase G
3	PF08241 Methyltransf_11	0.0041	29.1	Methyltransferase domain
4	PF08242 Methyltransf_12	35	16.6	Methyltransferase domain
5	PF10294 Methyltransf_16	1e+02	14.1	Lysine methyltransferase
6	PF13489 Methyltransf_23	3.8	18.8	Methyltransferase domain
7	PF13649 Methyltransf_25	0.00011	34.2	Methyltransferase domain
8	PF13847 Methyltransf_31	0.5	21.6	Methyltransferase domain
9	PF02390 Methyltransf_4	2.1e+02	12.8	Putative methyltransferase
10	PF08003 Methyltransf_9	3	18.3	Protein of unknown function (DUF1698)
11	PF02475 Met_10	0.74	21.1	Met-10+ like-protein
12	PF05175 MTS	0.8	20.8	Methyltransferase small domain
13	PF01135 PCMT	31	15.8	Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT)
14	PF06325 PrmA	7e-06	37.3	Ribosomal protein L11 methyltransferase (PrmA)
15	PF17286 PRMT5_C	3.4e+02	12.5	PRMT5 oligomerisation domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000372067

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319169	0.911	Protein arginine N-methyltransferase 5
2	9606.ENSP00000406162	0.885	Protein arginine N-methyltransferase 1
3	9606.ENSP00000358635	0.877	Heterogeneous nuclear ribonucleoprotein Q
4	9606.ENSP00000283179	0.859	Heterogeneous nuclear ribonucleoprotein U
5	9606.ENSP00000221801	0.857	rRNA 2'-O-methyltransferase fibrillarin
6	9606.ENSP00000341885	0.782	Ribosomal protein S2
7	9606.ENSP00000225698	0.746	Complement component 1 Q subcomponent-binding protein, mitochondrial
8	9606.ENSP00000301788	0.732	DNA-directed RNA polymerase II subunit RPB7
9	9606.ENSP00000400142	0.720	RNA-binding protein EWS
10	9606.ENSP00000333934	0.718	tRNA (guanine(10)-N2)-methyltransferase homolog
11	9606.ENSP00000382163	0.712	Belongs to the class V-like SAM-binding methyltransferase superfamily. SETD4 family
12	9606.ENSP00000362674	0.696	Histone deacetylase 8
13	9606.ENSP00000413572	0.692	Notchless protein homolog 1
14	9606.ENSP00000261015	0.689	Ribosome biogenesis protein WDR12
15	9606.ENSP00000274606	0.671	H/ACA ribonucleoprotein complex subunit 2
16	9606.ENSP00000354040	0.653	Nucleolar GTP-binding protein 1
17	9606.ENSP00000387365	0.643	Periodic tryptophan protein 1 homolog
18	9606.ENSP00000380982	0.635	Pumilio homolog 3
19	9606.ENSP00000226796	0.633	H/ACA ribonucleoprotein complex subunit 1
20	9606.ENSP00000296792	0.633	U3 small nucleolar RNA-associated protein 15 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0016274	0.993	protein-arginine N-methyltransferase activity
GO:0005515	0.987	protein binding
GO:0042054	0.944	histone methyltransferase activity
GO:1904047	0.745	S-adenosyl-L-methionine binding
GO:0035242	0.690	protein-arginine omega-N asymmetric methyltransferase activity
GO:0003676	0.647	nucleic acid binding
GO:0008469	0.592	histone arginine N-methyltransferase activity
GO:0035241	0.474	protein-arginine omega-N monomethyltransferase activity
GO:0019899	0.443	enzyme binding
GO:0042802	0.360	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.994	primary metabolic process
GO:0044237	0.993	cellular metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.986	macromolecule metabolic process
GO:0008213	0.963	protein alkylation
GO:0006479	0.935	protein methylation
GO:0065007	0.925	biological regulation
GO:0071840	0.885	cellular component organization or biogenesis
GO:0018193	0.879	peptidyl-amino acid modification
GO:0016570	0.844	histone modification
GO:0016043	0.814	cellular component organization
GO:0016571	0.779	histone methylation
GO:0018195	0.756	peptidyl-arginine modification
GO:0050789	0.690	regulation of biological process
GO:0050794	0.541	regulation of cellular process
GO:0032501	0.414	multicellular organismal process
GO:0032502	0.381	developmental process
GO:0019222	0.358	regulation of metabolic process
GO:0043933	0.354	protein-containing complex organization
GO:0051171	0.335	regulation of nitrogen compound metabolic process
GO:0080090	0.334	regulation of primary metabolic process
GO:0060255	0.332	regulation of macromolecule metabolic process
GO:0034641	0.330	cellular nitrogen compound metabolic process
GO:0031323	0.326	regulation of cellular metabolic process
GO:0046483	0.320	heterocycle metabolic process
GO:0006725	0.320	cellular aromatic compound metabolic process
GO:1901360	0.316	organic cyclic compound metabolic process
GO:0044085	0.303	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.998	intracellular anatomical structure
GO:0005634	0.981	nucleus
GO:0016020	0.973	membrane
GO:0005654	0.952	nucleoplasm
GO:0032991	0.947	protein-containing complex
GO:0005737	0.934	cytoplasm
GO:0005829	0.874	cytosol
GO:0005886	0.694	plasma membrane
GO:0043232	0.419	intracellular non-membrane-bounded organelle
GO:0009897	0.381	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.993	Methyltransferases.
RHEA:48096	0.690	L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine
EC:2.1.1.319	0.690	type I protein arginine methyltransferase.
RHEA:48100	0.474	L-arginyl-[protein] + S-adenosyl-L-methionine = H(+) + N(omega)-methyl-L-arginyl-[protein] + S-adenosyl-L-homocysteine
EC:2.1.1.321	0.474	type III protein arginine methyltransferase.

[back to server]