StarFunc result for job id Q9NR23

User Input

>input (364 residues)
MLRFLPDLAFSFLLILALGQAVQFQEYVFLQFLGLDKAPSPQKFQPVPYILKKIFQDREA
AATTGVSRDLCYVKELGVRGNVLRFLPDQGFFLYPKKISQASSCLQKLLYFNLSAIKERE
QLTLAQLGLDLGPNSYYNLGPELELALFLVQEPHVWGQTTPKPGKMFVLRSVPWPQGAVH
FNLLDVAKDWNDNPRKNFGLFLEILVKEDRDSGVNFQPEDTCARLRCSLHASLLVVTLNP
DQCHPSRKRRAAIPVPKLSCKNLCHRHQLFINFRDLGWHKWIIAPKGFMANYCHGECPFS
LTISLNSSNYAFMQALMHAVDPEIPQAVCIPTKLSPISMLYQDNNDNVILRHYEDMVVDE
CGCG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NR23	1.000	1.000	2.232E-73	364	1.000	1.000	Q9NR23.pdb.gz	GDF3_HUMAN Growth/differentiation factor 3 OS=Homo sapiens OX=9606 GN=GDF3 PE=1 SV=3
2	AFDB:Q07104	0.889	0.884	1.048E-51	366	0.676	0.672	Q07104.pdb.gz	GDF3_MOUSE Growth/differentiation factor 3 OS=Mus musculus OX=10090 GN=Gdf3 PE=1 SV=2
3	AFDB:Q98950	0.848	0.829	4.999E-40	373	0.467	0.456	Q98950.pdb.gz	Q98950_CHICK CVg1 protein OS=Gallus gallus OX=9031 GN=cVg1 PE=2 SV=1
4	AFDB:Q9YGV1	0.832	0.855	1.843E-38	354	0.420	0.432	Q9YGV1.pdb.gz	GDF3_XENLA Growth/differentiation factor 3 OS=Xenopus laevis OX=8355 GN=gdf3 PE=1 SV=1
5	AFDB:P35621	0.824	0.844	2.388E-36	355	0.412	0.423	P35621.pdb.gz	DVR1_DANRE Protein DVR-1 OS=Danio rerio OX=7955 GN=dvr1 PE=2 SV=1
6	AFDB:P20863	0.736	0.750	3.333E-29	357	0.338	0.345	P20863.pdb.gz	GDF1_MOUSE Embryonic growth/differentiation factor 1 OS=Mus musculus OX=10090 GN=Gdf1 PE=2 SV=2
7	AFDB:Q90751	0.702	0.722	1.448E-27	353	0.277	0.286	Q90751.pdb.gz	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
8	AFDB:F1QAD6	0.695	0.639	4.561E-27	400	0.272	0.247	F1QAD6.pdb.gz
9	AFDB:P12644	0.683	0.618	5.676E-27	408	0.277	0.248	P12644.pdb.gz	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
10	AFDB:C8C060	0.698	0.647	9.283E-27	396	0.275	0.253	C8C060.pdb.gz	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
11	PDB:5hlyA	0.252	0.298	6.366E-14	299	0.192	0.234	5hlyA.pdb.gz
12	PDB:5ntuA	0.292	0.340	1.041E-13	308	0.220	0.260	5ntuA.pdb.gz
13	PDB:5nxsA	0.287	0.351	1.368E-13	290	0.225	0.283	5nxsA.pdb.gz
14	PDB:6umxA	0.285	0.353	1.435E-12	279	0.201	0.262	6umxA.pdb.gz
15	PDB:3rjrC	0.222	0.235	4.251E-11	343	0.201	0.213	3rjrC.pdb.gz
16	PDB:5ffoG	0.242	0.285	1.761E-10	297	0.192	0.236	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
17	PDB:5vqfB	0.245	0.272	1.761E-10	320	0.198	0.225	5vqfB.pdb.gz
18	PDB:7y1rB	0.226	0.259	5.860E-10	308	0.181	0.214	7y1rB.pdb.gz
19	PDB:5nxsB	0.237	0.332	3.369E-9	251	0.187	0.271	5nxsB.pdb.gz
20	PDB:6q2sA	0.178	0.526	2.086E-3	98	0.055	0.204	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NR23	0.0	753	364	1.000	1.000	GDF3_HUMAN Growth/differentiation factor 3 OS=Homo sapiens OX=9606 GN=GDF3 PE=1 SV=3
2	Q07104	6.63e-176	495	366	0.681	0.678	GDF3_MOUSE Growth/differentiation factor 3 OS=Mus musculus OX=10090 GN=Gdf3 PE=1 SV=2
3	Q9YGV1	1.08e-90	278	354	0.418	0.429	GDF3_XENLA Growth/differentiation factor 3 OS=Xenopus laevis OX=8355 GN=gdf3 PE=1 SV=1
4	Q98950	3.00e-89	275	373	0.464	0.453	Q98950_CHICK CVg1 protein OS=Gallus gallus OX=9031 GN=cVg1 PE=2 SV=1
5	P35621	1.13e-86	268	355	0.409	0.420	DVR1_DANRE Protein DVR-1 OS=Danio rerio OX=7955 GN=dvr1 PE=2 SV=1
6	P20863	8.92e-60	198	357	0.371	0.378	GDF1_MOUSE Embryonic growth/differentiation factor 1 OS=Mus musculus OX=10090 GN=Gdf1 PE=2 SV=2
7	P49001	4.14e-46	164	393	0.297	0.275	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
8	C8C060	1.55e-45	162	396	0.305	0.280	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
9	P12643	1.55e-45	162	396	0.305	0.280	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
10	P21274	3.66e-44	158	394	0.294	0.272	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
11	Q90751	1.18e-43	156	353	0.291	0.300	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
12	O93369	1.67e-43	157	411	0.310	0.275	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
13	P12644	1.98e-43	157	408	0.305	0.272	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
14	O57574	6.51e-43	155	400	0.305	0.278	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
15	Q06826	1.56e-41	152	408	0.305	0.272	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1
16	A5HMF8	3.83e-41	150	404	0.294	0.265	A5HMF8_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=2 SV=1
17	A5HMF9	5.17e-41	150	404	0.294	0.265	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
18	P21275	9.78e-41	150	408	0.305	0.272	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
19	Q90752	2.40e-40	149	405	0.288	0.259	BMP4_CHICK Bone morphogenetic protein 4 OS=Gallus gallus OX=9031 GN=BMP4 PE=1 SV=1
20	O13109	2.42e-38	143	386	0.302	0.285	O13109_DANRE BMP2 OS=Danio rerio OX=7955 GN=BMP2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	0.0086	27.3	TGF-beta propeptide
2	PF00019 TGF_beta	7.1e-30	115.3	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000331745

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000243349	0.975	Activin receptor type-1C
2	9606.ENSP00000340361	0.891	Activin receptor type-2B
3	9606.ENSP00000296145	0.881	Teratocarcinoma-derived growth factor 1
4	9606.ENSP00000241416	0.871	Activin receptor type-2A
5	9606.ENSP00000229307	0.837	Homeobox protein NANOG
6	9606.ENSP00000335306	0.829	Developmental pluripotency-associated protein 4
7	9606.ENSP00000259915	0.805	POU domain, class 5, transcription factor 1
8	9606.ENSP00000363314	0.792	Protein lin-28 homolog A
9	9606.ENSP00000370745	0.767	ATP-dependent RNA helicase DDX1
10	9606.ENSP00000323588	0.735	Transcription factor SOX-2
11	9606.ENSP00000355785	0.722	Left-right determination factor 2
12	9606.ENSP00000379138	0.722	Alpha-fetoprotein
13	9606.ENSP00000168712	0.714	Fibroblast growth factor 4
14	9606.ENSP00000305906	0.682	Undifferentiated embryonic cell transcription factor 1
15	9606.ENSP00000328547	0.670	DNA (cytosine-5)-methyltransferase 3B
16	9606.ENSP00000417710	0.669	Developmental pluripotency-associated protein 2
17	9606.ENSP00000321684	0.653	Homeobox protein MOX-1
18	9606.ENSP00000261980	0.643	Visual system homeobox 2
19	9606.ENSP00000272134	0.641	Left-right determination factor 1
20	9606.ENSP00000363804	0.635	Krueppel-like factor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.702	signaling receptor binding
GO:0098772	0.617	molecular function regulator activity
GO:0019901	0.566	protein kinase binding
GO:0140677	0.464	molecular function activator activity
GO:0030545	0.437	signaling receptor regulator activity
GO:0048018	0.427	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0032501	0.994	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0009987	0.982	cellular process
GO:0048519	0.976	negative regulation of biological process
GO:0050793	0.960	regulation of developmental process
GO:0048523	0.960	negative regulation of cellular process
GO:0048518	0.959	positive regulation of biological process
GO:0007275	0.959	multicellular organism development
GO:0048583	0.906	regulation of response to stimulus
GO:0048513	0.905	animal organ development
GO:0090092	0.898	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0048731	0.885	system development
GO:0048522	0.877	positive regulation of cellular process
GO:0045595	0.874	regulation of cell differentiation
GO:0051239	0.851	regulation of multicellular organismal process
GO:0050896	0.822	response to stimulus
GO:0090287	0.716	regulation of cellular response to growth factor stimulus
GO:2000026	0.703	regulation of multicellular organismal development
GO:0019222	0.686	regulation of metabolic process
GO:0009888	0.670	tissue development
GO:0080090	0.668	regulation of primary metabolic process
GO:0051171	0.666	regulation of nitrogen compound metabolic process
GO:0060255	0.664	regulation of macromolecule metabolic process
GO:0031323	0.642	regulation of cellular metabolic process
GO:0051093	0.588	negative regulation of developmental process
GO:0030510	0.550	regulation of BMP signaling pathway
GO:0010468	0.512	regulation of gene expression
GO:0019219	0.476	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.467	regulation of cellular biosynthetic process
GO:0010556	0.466	regulation of macromolecule biosynthetic process
GO:0009653	0.465	anatomical structure morphogenesis
GO:0051716	0.458	cellular response to stimulus
GO:0009893	0.438	positive regulation of metabolic process
GO:0051252	0.431	regulation of RNA metabolic process
GO:0010604	0.429	positive regulation of macromolecule metabolic process
GO:0045596	0.421	negative regulation of cell differentiation
GO:0007154	0.401	cell communication
GO:0006355	0.395	regulation of DNA-templated transcription
GO:0030856	0.393	regulation of epithelial cell differentiation
GO:0023052	0.386	signaling
GO:0010453	0.356	regulation of cell fate commitment
GO:0051173	0.352	positive regulation of nitrogen compound metabolic process
GO:0045682	0.350	regulation of epidermis development
GO:0070848	0.349	response to growth factor
GO:0010648	0.328	negative regulation of cell communication
GO:0009790	0.321	embryo development
GO:0007165	0.315	signal transduction
GO:0030154	0.308	cell differentiation
GO:0031325	0.307	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0043226	0.777	organelle
GO:0043229	0.724	intracellular organelle
GO:0005576	0.708	extracellular region
GO:0043227	0.626	membrane-bounded organelle
GO:0070013	0.435	intracellular organelle lumen
GO:0005634	0.363	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]