StarFunc result for job id Q9NR28

User Input

>input (239 residues)
MAALKSWLSRSVTSFFRYRQCLCVPVVANFKKRCFSELIRPWHKTVTIGFGVTLCAVPIA
QKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSL
LGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQAS
ITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z5U7	0.946	0.946	8.630E-28	239	1.000	1.000	A0A0S2Z5U7.pdb.gz	A0A0S2Z5U7_HUMAN Direct IAP-binding protein with low pI (Fragment) OS=Homo sapiens OX=9606 GN=DIABLO PE=2 SV=1
2	AFDB:Q5RK17	0.775	0.782	1.589E-22	237	0.795	0.802	Q5RK17.pdb.gz	Q5RK17_RAT Direct IAP-binding protein with low pI OS=Rattus norvegicus OX=10116 GN=Diablo PE=1 SV=1
3	AFDB:A4GZV0	0.670	0.657	1.239E-15	244	0.477	0.467	A4GZV0.pdb.gz	DBLOH_XENLA Diablo homolog, mitochondrial OS=Xenopus laevis OX=8355 GN=diablo PE=2 SV=1
4	AFDB:A0A0S2Z5P6	0.595	0.724	8.065E-15	195	0.699	0.856	A0A0S2Z5P6.pdb.gz	A0A0S2Z5P6_HUMAN Direct IAP-binding protein with low pI (Fragment) OS=Homo sapiens OX=9606 GN=DIABLO PE=2 SV=1
5	AFDB:B9A067	0.407	0.181	3.033E-4	711	0.146	0.049	B9A067.pdb.gz	B9A067_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=2
6	AFDB:Q16891	0.394	0.165	4.599E-4	758	0.146	0.046	Q16891.pdb.gz	MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT PE=1 SV=1
7	AFDB:Q9XXN2	0.606	0.231	5.376E-4	654	0.142	0.052	Q9XXN2.pdb.gz	IMMT2_CAEEL MICOS complex subunit MIC60-2 OS=Caenorhabditis elegans OX=6239 GN=immt-2 PE=2 SV=2
8	AFDB:Q22505	0.584	0.219	5.663E-4	679	0.100	0.035	Q22505.pdb.gz	IMMT1_CAEEL MICOS complex subunit MIC60-1 OS=Caenorhabditis elegans OX=6239 GN=immt-1 PE=2 SV=2
9	AFDB:Q3KR86	0.414	0.196	8.152E-4	609	0.121	0.048	Q3KR86.pdb.gz	MIC60_RAT MICOS complex subunit Mic60 (Fragment) OS=Rattus norvegicus OX=10116 GN=Immt PE=1 SV=1
10	AFDB:Q9SUJ1	0.308	0.246	1.285E-2	331	0.130	0.094	Q9SUJ1.pdb.gz	SYP43_ARATH Syntaxin-43 OS=Arabidopsis thaliana OX=3702 GN=SYP43 PE=2 SV=2
11	PDB:7n6g3I	0.314	0.199	7.194E-2	401	0.121	0.072	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
12	PDB:6xz6A	0.201	0.220	8.859E-2	213	0.130	0.146	6xz6A.pdb.gz
13	PDB:7q83D	0.210	0.314	2.145E-1	156	0.071	0.109	7q83D.pdb.gz
14	PDB:4yknA	0.333	0.080	2.642E-1	1205	0.063	0.012	4yknA.pdb.gz	Discovery of a Potent Class of PI3K alpha Inhibitors with Unique Binding Mode via Encoded Library Technology (ELT).
15	PDB:2b5uA	0.184	0.105	2.783E-1	470	0.063	0.032	2b5uA.pdb.gz
16	PDB:3k29A	0.346	0.500	2.783E-1	162	0.096	0.142	3k29A.pdb.gz
17	PDB:1qoyA	0.340	0.285	3.088E-1	303	0.100	0.079	1qoyA.pdb.gz
18	PDB:6zh5A	0.218	0.283	4.220E-1	178	0.084	0.112	6zh5A.pdb.gz
19	PDB:7nsuD	0.265	0.167	4.220E-1	420	0.050	0.029	7nsuD.pdb.gz
20	PDB:5njxA	0.147	0.091	5.196E-1	413	0.121	0.070	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z5U7	1.05e-177	489	239	1.000	1.000	A0A0S2Z5U7_HUMAN Direct IAP-binding protein with low pI (Fragment) OS=Homo sapiens OX=9606 GN=DIABLO PE=2 SV=1
2	Q9NR28	1.05e-177	489	239	1.000	1.000	DBLOH_HUMAN Diablo IAP-binding mitochondrial protein OS=Homo sapiens OX=9606 GN=DIABLO PE=1 SV=1
3	Q9JIQ3	6.45e-146	408	237	0.849	0.857	DBLOH_MOUSE Diablo IAP-binding mitochondrial protein OS=Mus musculus OX=10090 GN=Diablo PE=1 SV=2
4	Q5RK17	9.46e-146	408	237	0.849	0.857	Q5RK17_RAT Direct IAP-binding protein with low pI OS=Rattus norvegicus OX=10116 GN=Diablo PE=1 SV=1
5	A0A0S2Z5P6	1.85e-127	360	195	0.816	1.000	A0A0S2Z5P6_HUMAN Direct IAP-binding protein with low pI (Fragment) OS=Homo sapiens OX=9606 GN=DIABLO PE=2 SV=1
6	A0A024RBT2	9.82e-116	329	166	0.695	1.000	A0A024RBT2_HUMAN Direct IAP-binding protein with low pI OS=Homo sapiens OX=9606 GN=DIABLO PE=1 SV=1
7	F7F5S4	2.52e-107	311	238	0.640	0.643	F7F5S4_RAT Direct IAP-binding protein with low pI OS=Rattus norvegicus OX=10116 GN=Diablo PE=1 SV=1
8	A0A8I5ZR69	4.53e-107	308	174	0.636	0.874	A0A8I5ZR69_RAT Direct IAP-binding protein with low pI OS=Rattus norvegicus OX=10116 GN=Diablo PE=4 SV=1
9	A0A8I6A7T3	5.80e-84	248	156	0.510	0.782	A0A8I6A7T3_RAT Direct IAP-binding protein with low pI OS=Rattus norvegicus OX=10116 GN=Diablo PE=4 SV=1
10	A4GZV0	5.53e-77	234	244	0.531	0.520	DBLOH_XENLA Diablo homolog, mitochondrial OS=Xenopus laevis OX=8355 GN=diablo PE=2 SV=1
11	Q5U393	3.7	31.2	1457	0.059	0.010	Q5U393_DANRE Cleavage and polyadenylation factor subunit, homolog (S. cerevisiae) OS=Danio rerio OX=7955 GN=zgc:175013 PE=1 SV=1
12	A0A1D8PJG4	3.9	31.2	1302	0.096	0.018	A0A1D8PJG4_CANAL RSC chromatin remodeling complex ATPase subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=STH1 PE=4 SV=1
13	Q99M73	4.9	30.8	603	0.176	0.070	KRT84_MOUSE Keratin, type II cuticular Hb4 OS=Mus musculus OX=10090 GN=Krt84 PE=2 SV=2
14	P11497	5.2	30.8	2345	0.075	0.008	ACACA_RAT Acetyl-CoA carboxylase 1 OS=Rattus norvegicus OX=10116 GN=Acaca PE=1 SV=1
15	Q5SWU9	5.2	30.8	2345	0.075	0.008	ACACA_MOUSE Acetyl-CoA carboxylase 1 OS=Mus musculus OX=10090 GN=Acaca PE=1 SV=1
16	Q9NSB2	5.5	30.8	600	0.180	0.072	KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens OX=9606 GN=KRT84 PE=2 SV=2
17	O88720	5.6	30.8	1117	0.100	0.021	O88720_MOUSE RNA binding protein OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=2
18	Q5DTS4	6.1	30.8	1109	0.100	0.022	Q5DTS4_MOUSE MKIAA4015 protein (Fragment) OS=Mus musculus OX=10090 GN=Rbm6 PE=2 SV=1
19	S4R1W5	6.2	30.4	1118	0.100	0.021	S4R1W5_MOUSE RNA binding motif protein 6 OS=Mus musculus OX=10090 GN=Rbm6 PE=1 SV=1
20	G3H9D1	6.3	30.4	1579	0.075	0.011	G3H9D1_CRIGR Acetyl-CoA carboxylase 1 OS=Cricetulus griseus OX=10029 GN=I79_006999 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09057 Smac_DIABLO	5.9e-101	348.2	Second Mitochondria-derived Activator of Caspases

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000398495

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360242	0.999	E3 ubiquitin-protein ligase XIAP
2	9606.ENSP00000477613	0.999	Baculoviral IAP repeat-containing protein 2
3	9606.ENSP00000217169	0.998	Baculoviral IAP repeat-containing protein 7
4	9606.ENSP00000263464	0.998	Baculoviral IAP repeat-containing protein 3
5	9606.ENSP00000330237	0.995	Caspase-9
6	9606.ENSP00000448165	0.995	Apoptotic protease-activating factor 1
7	9606.ENSP00000345708	0.987	ATP-sensitive inward rectifier potassium channel 11
8	9606.ENSP00000302564	0.978	Bcl-2-like protein 1
9	9606.ENSP00000393596	0.971	Baculoviral IAP repeat-containing protein 6
10	9606.ENSP00000258080	0.966	Serine protease HTRA2, mitochondrial
11	9606.ENSP00000412957	0.965	Baculoviral IAP repeat-containing protein 8
12	9606.ENSP00000293288	0.954	Apoptosis regulator BAX
13	9606.ENSP00000307786	0.951	Cytochrome c
14	9606.ENSP00000363591	0.946	Bcl-2 homologous antagonist/killer
15	9606.ENSP00000311032	0.942	Caspase-3
16	9606.ENSP00000301633	0.940	Baculoviral IAP repeat containing 5
17	9606.ENSP00000381185	0.932	Apoptosis regulator Bcl-2
18	9606.ENSP00000247668	0.930	TNF receptor-associated factor 2
19	9606.ENSP00000378217	0.919	Protein kinase C delta type
20	9606.ENSP00000358327	0.892	Caspase-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0042981	0.990	regulation of apoptotic process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0080090	0.986	regulation of primary metabolic process
GO:0051171	0.986	regulation of nitrogen compound metabolic process
GO:0043068	0.986	positive regulation of programmed cell death
GO:0097190	0.986	apoptotic signaling pathway
GO:0043065	0.982	positive regulation of apoptotic process
GO:0006919	0.966	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0035556	0.964	intracellular signal transduction
GO:0097193	0.938	intrinsic apoptotic signaling pathway
GO:0007166	0.865	cell surface receptor signaling pathway
GO:0097191	0.453	extrinsic apoptotic signaling pathway
GO:0042221	0.390	response to chemical
GO:0006950	0.378	response to stress
GO:0070887	0.361	cellular response to chemical stimulus
GO:0008625	0.321	extrinsic apoptotic signaling pathway via death domain receptors

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005829	0.978	cytosol
GO:0070013	0.893	intracellular organelle lumen
GO:0016020	0.793	membrane
GO:0032991	0.490	protein-containing complex
GO:0005740	0.450	mitochondrial envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]