StarFunc result for job id Q9NR30

User Input

>input (783 residues)
MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKK
KAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEP
SEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP
VEQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSF
AIPLIEKLHGELQDRKRGRAPQVLVLAPTRELANQVSKDFSDITKKLSVACFYGGTPYGG
QFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEEILSVA
YKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDLIGKKTQKTAITVEHLAIKCHW
TQRAAVIGDVIRVYSGHQGRTIIFCETKKEAQELSQNSAIKQDAQSLHGDIPQKQREITL
KGFRNGSFGVLVATNVAARGLDIPEVDLVIQSSPPKDVESYIHRSGRTGRAGRTGVCICF
YQHKEEYQLVQVEQKAGIKFKRIGVPSATEIIKASSKDAIRLLDSVPPTAISHFKQSAEK
LIEEKGAVEALAAALAHISGATSVDQRSLINSNVGFVTMILQCSIEMPNISYAWKELKEQ
LGEEIDSKVKGMVFLKGKLGVCFDVPTASVTEIQEKWHDSRRWQLSVATEQPELEGPREG
YGGFRGQREGSRGFRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKA
FGQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JIK5	0.742	0.684	0.000	851	0.837	0.770	Q9JIK5.pdb.gz	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
2	AFDB:Q9NR30	1.000	1.000	0.000	783	1.000	1.000	Q9NR30.pdb.gz	DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5
3	AFDB:Q9DF36	0.715	0.701	4.045E-88	800	0.502	0.491	Q9DF36.pdb.gz	DD21B_XENLA Nucleolar RNA helicase 2-B OS=Xenopus laevis OX=8355 GN=ddx21-b PE=2 SV=2
4	AFDB:Q57Z07	0.645	0.793	1.681E-64	632	0.307	0.380	Q57Z07.pdb.gz	Q57Z07_TRYB2 RNA helicase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.770 PE=3 SV=1
5	AFDB:Q39189	0.654	0.758	2.209E-63	671	0.333	0.389	Q39189.pdb.gz	RH7_ARATH DEAD-box ATP-dependent RNA helicase 7 OS=Arabidopsis thaliana OX=3702 GN=RH7 PE=1 SV=2
6	AFDB:Q8L7S8	0.600	0.626	5.419E-58	748	0.310	0.325	Q8L7S8.pdb.gz	RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RH3 PE=1 SV=2
7	PDB:7pliA	0.443	0.746	3.456E-36	457	0.176	0.302	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
8	AFDB:Q90ZF6	0.449	0.567	2.387E-34	617	0.192	0.243	Q90ZF6.pdb.gz	Q90ZF6_ORYLA RNA helicase OS=Oryzias latipes OX=8090 GN=olvas PE=2 SV=1
9	AFDB:Q09903	0.443	0.460	6.848E-34	754	0.193	0.200	Q09903.pdb.gz	DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=drs1 PE=3 SV=1
10	AFDB:Q03532	0.456	0.697	1.747E-33	505	0.171	0.265	Q03532.pdb.gz	HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HAS1 PE=1 SV=1
11	AFDB:Q5AK59	0.457	0.626	1.964E-33	565	0.174	0.241	Q5AK59.pdb.gz	HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HAS1 PE=3 SV=1
12	PDB:3ex7C	0.433	0.846	8.154E-29	392	0.151	0.301	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
13	PDB:7evoE	0.262	0.442	1.924E-27	455	0.158	0.273	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
14	PDB:1fuuB	0.254	0.511	2.385E-26	380	0.144	0.297	1fuuB.pdb.gz
15	PDB:7pq0B	0.262	0.514	2.206E-25	385	0.152	0.309	7pq0B.pdb.gz
16	PDB:6qw65X	0.269	0.352	1.277E-24	583	0.147	0.197	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
17	PDB:7evnE	0.260	0.414	1.679E-23	486	0.151	0.243	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
18	PDB:2j0uB	0.245	0.539	5.412E-23	347	0.132	0.297	2j0uB.pdb.gz	The Crystal Structure of the Exon Junction Complex Reveals How It Mantains a Stable Grip on Mrna
19	PDB:5zwny	0.242	0.459	6.452E-23	399	0.155	0.303	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
20	PDB:7oqbp	0.262	0.454	9.719E-23	444	0.140	0.248	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8K2L4	0.0	1159	689	0.756	0.859	Q8K2L4_MOUSE RNA helicase (Fragment) OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=1
2	Q9BQ39	0.0	801	737	0.516	0.548	DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1
3	Q9DF35	0.0	699	759	0.416	0.430	DD21A_XENLA Nucleolar RNA helicase 2-A OS=Xenopus laevis OX=8355 GN=ddx21-a PE=2 SV=2
4	Q9DF36	0.0	716	800	0.428	0.419	DD21B_XENLA Nucleolar RNA helicase 2-B OS=Xenopus laevis OX=8355 GN=ddx21-b PE=2 SV=2
5	Q9JIK5	0.0	1164	851	0.814	0.749	DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus OX=10090 GN=Ddx21 PE=1 SV=3
6	Q9NR30	0.0	1607	783	1.000	1.000	DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5
7	Q57Z07	4.90e-131	405	632	0.267	0.331	Q57Z07_TRYB2 RNA helicase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.45E22.770 PE=3 SV=1
8	Q39189	5.84e-131	406	671	0.284	0.331	RH7_ARATH DEAD-box ATP-dependent RNA helicase 7 OS=Arabidopsis thaliana OX=3702 GN=RH7 PE=1 SV=2
9	A0A1D6LAB7	1.55e-115	369	743	0.259	0.273	RH3B_MAIZE DEAD-box ATP-dependent RNA helicase 3B, chloroplastic OS=Zea mays OX=4577 GN=RH3B PE=2 SV=1
10	Q8L7S8	3.90e-108	349	748	0.286	0.299	RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=RH3 PE=1 SV=2
11	Q9LUW6	8.56e-103	331	610	0.215	0.275	RH9_ARATH DEAD-box ATP-dependent RNA helicase 9, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RH9 PE=1 SV=1
12	Q9LUW5	2.75e-99	322	616	0.217	0.276	RH53_ARATH DEAD-box ATP-dependent RNA helicase 53, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RH53 PE=1 SV=1
13	Q8I457	2.66e-94	313	755	0.226	0.234	Q8I457_PLAF7 RNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0504400 PE=3 SV=1
14	P96614	1.11e-76	258	494	0.201	0.318	CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) OX=224308 GN=cshA PE=1 SV=2
15	P0A9P6	2.18e-71	248	629	0.202	0.251	DEAD_ECOLI ATP-dependent RNA helicase DeaD OS=Escherichia coli (strain K12) OX=83333 GN=deaD PE=1 SV=2
16	O05855	6.58e-71	244	527	0.181	0.269	O05855_MYCTU Probable ATP-dependent RNA helicase RhlE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rhlE PE=1 SV=1
17	P9WH05	1.17e-67	236	563	0.178	0.247	DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=deaD PE=1 SV=1
18	C8V8H4	3.41e-64	229	668	0.192	0.225	DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ded1 PE=3 SV=1
19	P24784	1.22e-62	223	617	0.198	0.251	DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP1 PE=1 SV=2
20	Q72AL0	4.50e-62	218	462	0.171	0.290	Q72AL0_DESVH ATP-dependent RNA helicase RhlE OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=rhlE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13604 AAA_30	0.21	22.8	AAA domain
2	PF14617 CMS1	1.3	19.8	U3-containing 90S pre-ribosomal complex subunit
3	PF00270 DEAD	6.9e-44	161.2	DEAD/DEAH box helicase
4	PF16203 ERCC3_RAD25_C	10	16.9	ERCC3/RAD25/XPB C-terminal helicase
5	PF08152 GUCT	1.2e-26	104.1	GUCT (NUC152) domain
6	PF00271 Helicase_C	4.9e-27	105.8	Helicase conserved C-terminal domain
7	PF04851 ResIII	2.1e-05	36.1	Type III restriction enzyme, res subunit
8	PF00884 Sulfatase	6.2e+02	11.1	Sulfatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346120

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000417078	0.991	ATP-dependent RNA helicase DHX36
2	9606.ENSP00000407323	0.987	Probable rRNA-processing protein EBP2
3	9606.ENSP00000261015	0.967	Ribosome biogenesis protein WDR12
4	9606.ENSP00000354040	0.962	Nucleolar GTP-binding protein 1
5	9606.ENSP00000455106	0.962	Ribosome biogenesis protein BOP1
6	9606.ENSP00000364037	0.951	Testis-expressed protein 10
7	9606.ENSP00000263657	0.946	RNA-binding protein PNO1
8	9606.ENSP00000395772	0.946	Guanine nucleotide-binding protein-like 3
9	9606.ENSP00000346725	0.942	Pescadillo homolog
10	9606.ENSP00000476117	0.934	WD repeat-containing protein 18
11	9606.ENSP00000434024	0.929	Histone H2AX
12	9606.ENSP00000363944	0.928	Ribosomal biogenesis protein LAS1L
13	9606.ENSP00000335321	0.921	Splicing factor 3B subunit 1
14	9606.ENSP00000314029	0.917	Sentrin-specific protease 3
15	9606.ENSP00000301396	0.916	Proline-, glutamic acid- and leucine-rich protein 1
16	9606.ENSP00000296417	0.909	Histone H2A.Z
17	9606.ENSP00000289316	0.907	Histone H2B type 1-D
18	9606.ENSP00000332194	0.906	Histone H2A type 2-C
19	9606.ENSP00000460871	0.906	Ribosomal L1 domain-containing protein 1
20	9606.ENSP00000477527	0.906	Histone H2B type 1-O

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003724	0.995	RNA helicase activity
GO:0019843	0.332	rRNA binding
GO:0061980	0.329	regulatory RNA binding
GO:0017069	0.325	snRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0043170	0.997	macromolecule metabolic process
GO:0034641	0.996	cellular nitrogen compound metabolic process
GO:0090304	0.991	nucleic acid metabolic process
GO:0050789	0.984	regulation of biological process
GO:0016070	0.963	RNA metabolic process
GO:0071840	0.942	cellular component organization or biogenesis
GO:0050794	0.941	regulation of cellular process
GO:0010467	0.895	gene expression
GO:0019222	0.893	regulation of metabolic process
GO:0048518	0.880	positive regulation of biological process
GO:0060255	0.858	regulation of macromolecule metabolic process
GO:0010468	0.720	regulation of gene expression
GO:0031323	0.599	regulation of cellular metabolic process
GO:0080090	0.587	regulation of primary metabolic process
GO:0051171	0.579	regulation of nitrogen compound metabolic process
GO:0048522	0.513	positive regulation of cellular process
GO:0009893	0.478	positive regulation of metabolic process
GO:0009889	0.456	regulation of biosynthetic process
GO:0010604	0.454	positive regulation of macromolecule metabolic process
GO:0019219	0.453	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.446	regulation of macromolecule biosynthetic process
GO:0031326	0.442	regulation of cellular biosynthetic process
GO:0051252	0.435	regulation of RNA metabolic process
GO:0031325	0.417	positive regulation of cellular metabolic process
GO:0051173	0.387	positive regulation of nitrogen compound metabolic process
GO:0016043	0.359	cellular component organization
GO:0009058	0.302	biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0005730	0.984	nucleolus
GO:0032991	0.976	protein-containing complex
GO:0016020	0.939	membrane
GO:0005737	0.931	cytoplasm
GO:0005654	0.896	nucleoplasm
GO:0005829	0.757	cytosol
GO:1902494	0.694	catalytic complex
GO:0140513	0.685	nuclear protein-containing complex
GO:0005694	0.557	chromosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.995	RNA helicase.

[back to server]