StarFunc result for job id Q9NR34

User Input

>input (630 residues)
MLMRKVPGFVPASPWGLRLPQKFLFLLFLSGLVTLCFGALFLLPHSSRLKRLFLAPRTQQ
PGLEVVAEIAGHAPAREQEPPPNPAPAAPAPGEDDPSSWASPRRRKGGLRRTRPTGPREE
ATAARGNSIPASRPGDEGVPFRFDFNAFRSRLRHPVLGTRADESQEPQSQVRAQREKIKE
MMQFAWQSYKRYAMGKNELRPLTKDGYEGNMFGGLSGATVIDSLDTLYLMELKEEFQEAK
AWVGESFHLNVSGEASLFEVNIRYIGGLLSAFYLTGEEVFRIKAIRLGEKLLPAFNTPTG
IPKGVVSFKSGNWGWATAGSSSILAEFGSLHLEFLHLTELSGNQVFAEKVRNIRKVLRKI
EKPFGLYPNFLSPVSGNWVQHHVSVGGLGDSFYEYLIKSWLMSGKTDMEAKNMYYEALEA
IETYLLNVSPGGLTYIAEWRGGILDHKMGHLACFSGGMIALGAEDAKEEKRAHYRELAAQ
ITKTCHESYARSDTKLGPEAFWFNSGREAVATQLSESYYILRPEVVESYMYLWRQTHNPI
YREWGWEVVLALEKYCRTEAGFSGIQDVYSSTPNHDNKQQSFFLAETLKYLYLLFSEDDL
LSLEDWVFNTEAHPLPVNHSDSSGRAWGRH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NR34	1.000	1.000	6.860E-100	630	1.000	1.000	Q9NR34.pdb.gz	MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
2	AFDB:P45700	0.710	0.684	9.243E-59	655	0.521	0.501	P45700.pdb.gz	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
3	AFDB:O60476	0.707	0.695	1.288E-58	641	0.508	0.499	O60476.pdb.gz	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
4	AFDB:P53624	0.733	0.693	1.382E-54	667	0.457	0.432	P53624.pdb.gz	MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
5	AFDB:Q9C512	0.681	0.764	3.580E-43	560	0.322	0.362	Q9C512.pdb.gz	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
6	AFDB:Q8H116	0.688	0.756	4.841E-42	572	0.325	0.358	Q8H116.pdb.gz	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
7	AFDB:Q9VAP8	0.688	0.635	1.176E-39	685	0.279	0.257	Q9VAP8.pdb.gz	Q9VAP8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ib PE=1 SV=1
8	AFDB:Q93Y37	0.684	0.691	1.089E-38	624	0.316	0.319	Q93Y37.pdb.gz	MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
9	AFDB:Q9P7C3	0.686	0.826	2.645E-36	521	0.244	0.296	Q9P7C3.pdb.gz	MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
10	PDB:1dl2A	0.661	0.812	5.008E-34	510	0.256	0.316	1dl2A.pdb.gz
11	PDB:1fp3A	0.407	0.592	3.738E-5	402	0.081	0.127	1fp3A.pdb.gz
12	PDB:2rgkA	0.368	0.516	1.221E-4	409	0.063	0.098	2rgkA.pdb.gz
13	PDB:3qxqA	0.314	0.522	4.821E-4	338	0.057	0.107	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
14	PDB:3t33A	0.369	0.520	4.821E-4	407	0.083	0.128	3t33A.pdb.gz	Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins
15	PDB:3aniA	0.284	0.429	8.922E-4	378	0.052	0.087	3aniA.pdb.gz
16	PDB:6wq1A	0.401	0.584	9.808E-4	396	0.098	0.157	6wq1A.pdb.gz	LanCLs add glutathione to dehydroamino acids generated at phosphorylated sites in the proteome.
17	PDB:3e6uA	0.364	0.517	1.303E-3	409	0.087	0.134	3e6uA.pdb.gz	Structure of human lanthionine synthetase C-like protein 1 and its interaction with Eps8 and glutathione
18	PDB:3vxdC	0.279	0.450	3.056E-3	359	0.057	0.100	3vxdC.pdb.gz
19	PDB:6trhC	0.280	0.402	4.060E-3	385	0.076	0.125	6trhC.pdb.gz	Structural analysis of the reducing-end xylose-releasing exo-oligoxylanase Rex8A from Paenibacillus barcinonensis BP-23 deciphers its molecular specificity.
20	AFDB:H9G2Q2	0.126	0.084	1.962E-2	1179	0.114	0.061	H9G2Q2.pdb.gz	H9G2Q2_CAEEL Rap-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hgap-2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O60476	0.0	631	641	0.506	0.498	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
2	P33908	0.0	661	653	0.540	0.521	MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens OX=9606 GN=MAN1A1 PE=1 SV=3
3	P39098	0.0	611	641	0.503	0.495	MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
4	P45700	0.0	669	655	0.530	0.510	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
5	Q9NR34	0.0	1296	630	1.000	1.000	MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
6	P53624	4.83e-180	527	667	0.402	0.379	MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
7	O18498	9.26e-165	488	670	0.370	0.348	MA1A1_SPOFR Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
8	Q9C512	1.53e-126	386	560	0.332	0.373	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
9	Q8H116	1.94e-123	379	572	0.335	0.369	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
10	Q9UKM7	3.51e-97	314	699	0.338	0.305	MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
11	A2AJ15	6.72e-95	307	658	0.284	0.272	MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
12	Q93Y37	2.19e-86	284	624	0.283	0.285	MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
13	A2RBC3	1.47e-81	270	603	0.270	0.282	A2RBC3_ASPNC alpha-1,2-Mannosidase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An18g06220 PE=3 SV=1
14	A0A1D8PD38	1.46e-80	268	615	0.273	0.280	A0A1D8PD38_CANAL alpha-1,2-Mannosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNS1 PE=3 SV=1
15	Q9VAP8	1.52e-80	270	685	0.249	0.229	Q9VAP8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ib PE=1 SV=1
16	Q9P7C3	2.09e-72	244	521	0.252	0.305	MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
17	P32906	4.25e-68	233	549	0.259	0.297	MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNS1 PE=1 SV=1
18	Q2UMC2	7.13e-66	231	711	0.257	0.228	Q2UMC2_ASPOR alpha-1,2-Mannosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000057 PE=3 SV=1
19	Q9SXC9	1.33e-54	197	574	0.235	0.258	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
20	Q8BJT9	5.74e-54	196	577	0.237	0.258	EDEM2_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01532 Glyco_hydro_47	1.8e-139	477.3	Glycosyl hydrolase family 47

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363452

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452948	0.982	Alpha-mannosidase 2x
2	9606.ENSP00000261483	0.974	Alpha-mannosidase 2
3	9606.ENSP00000404718	0.940	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
4	9606.ENSP00000340466	0.922	Neutral alpha-glucosidase AB
5	9606.ENSP00000360645	0.915	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
6	9606.ENSP00000466134	0.910	Glucosidase 2 subunit beta
7	9606.ENSP00000348959	0.905	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
8	9606.ENSP00000357453	0.905	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA
9	9606.ENSP00000417354	0.901	Golgi integral membrane protein 4
10	9606.ENSP00000306496	0.900	Ras-related protein Rab-33B
11	9606.ENSP00000351669	0.900	Glycoprotein endo-alpha-1,2-mannosidase
12	9606.ENSP00000355629	0.710	Conserved oligomeric Golgi complex subunit 2
13	9606.ENSP00000285599	0.705	Epididymis-specific alpha-mannosidase
14	9606.ENSP00000353401	0.674	Homeobox protein cut-like 1
15	9606.ENSP00000315775	0.667	Conserved oligomeric Golgi complex subunit 4
16	9606.ENSP00000324628	0.663	Gamma-soluble NSF attachment protein
17	9606.ENSP00000381293	0.663	Vesicle-fusing ATPase
18	9606.ENSP00000263354	0.650	Alpha-soluble NSF attachment protein
19	9606.ENSP00000482826	0.650	Beta-soluble NSF attachment protein
20	9606.ENSP00000305442	0.632	Conserved oligomeric Golgi complex subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005509	1.000	calcium ion binding
GO:0004571	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044260	0.992	cellular macromolecule metabolic process
GO:0019538	0.992	protein metabolic process
GO:0043412	0.989	macromolecule modification
GO:0036211	0.984	protein modification process
GO:0006517	0.952	protein deglycosylation
GO:0006486	0.936	protein glycosylation
GO:0006491	0.673	N-glycan processing
GO:0006487	0.588	protein N-linked glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	0.998	Golgi membrane
GO:0031982	0.991	vesicle
GO:0005576	0.990	extracellular region
GO:0070062	0.970	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.113	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase.

[back to server]