StarFunc result for job id Q9NR61

User Input

>input (685 residues)
MAAASRSASGWALLLLVALWQQRAAGSGVFQLQLQEFINERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYY
GDNCSRLCKKRNDHFGHYVCQPDGNLSCLPGWTGEYCQQPICLSGCHEQNGYCSKPAECL
CRPGWQGRLCNECIPHNGCRHGTCSTPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYHCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGANYACECPPNFTGSNCEKKVDRCTSNPCANGGQCLNR
GPSRMCRCRPGFTGTYCELHVSDCARNPCAHGGTCHDLENGLMCTCPAGFSGRRCEVRTS
IDACASSPCFNRATCYTDLSTDTFVCNCPYGFVGSRCEFPVGLPPSFPWVAVSLGVGLAV
LLVLLGMVAVAVRQLRLRRPDDGSREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMPGKFPHSDKSLGEKAPLRLHSEKPECRISAICS
PRDSMYQSVCLISEERNECVIATEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JI71	0.565	0.564	0.000	686	0.861	0.860	Q9JI71.pdb.gz	DLL4_MOUSE Delta-like protein 4 OS=Mus musculus OX=10090 GN=Dll4 PE=1 SV=2
2	AFDB:Q9NR61	1.000	1.000	0.000	685	1.000	1.000	Q9NR61.pdb.gz	DLL4_HUMAN Delta-like protein 4 OS=Homo sapiens OX=9606 GN=DLL4 PE=1 SV=1
3	AFDB:A0A2R8Q7E4	0.571	0.567	2.117E-88	690	0.565	0.561	A0A2R8Q7E4.pdb.gz
4	AFDB:Q5RGG6	0.365	0.387	2.546E-81	645	0.530	0.563	Q5RGG6.pdb.gz
5	AFDB:O57409	0.443	0.490	2.352E-71	615	0.423	0.472	O57409.pdb.gz	DLLB_DANRE Delta-like protein B OS=Danio rerio OX=7955 GN=dlb PE=1 SV=1
6	AFDB:P10041	0.423	0.352	3.436E-66	833	0.387	0.318	P10041.pdb.gz	DL_DROME Neurogenic locus protein delta OS=Drosophila melanogaster OX=7227 GN=Delta PE=1 SV=2
7	AFDB:Q90Y54	0.408	0.249	1.371E-60	1213	0.312	0.176	Q90Y54.pdb.gz	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
8	AFDB:A0A2R8QT22	0.415	0.241	6.924E-60	1216	0.305	0.172	A0A2R8QT22.pdb.gz
9	AFDB:Q63722	0.421	0.244	1.245E-57	1219	0.305	0.171	Q63722.pdb.gz	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
10	AFDB:Q9QYE5	0.396	0.228	2.434E-57	1247	0.318	0.175	Q9QYE5.pdb.gz	JAG2_MOUSE Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2
11	PDB:5izrC	0.150	0.156	1.998E-5	659	0.019	0.020	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
12	PDB:3nsjA	0.155	0.194	4.883E-5	530	0.042	0.055	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.
13	PDB:5ixcA	0.152	0.152	7.217E-5	684	0.022	0.022	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	PDB:7q3nU	0.089	0.151	1.491E-4	292	0.055	0.130	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
15	PDB:5iz5A	0.153	0.139	1.972E-4	757	0.025	0.022	5iz5A.pdb.gz
16	PDB:5iz5B	0.149	0.138	2.205E-4	746	0.023	0.021	5iz5B.pdb.gz
17	PDB:5es4B	0.105	0.106	3.446E-4	674	0.074	0.076	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
18	PDB:1cjyA	0.153	0.165	4.817E-4	633	0.026	0.028	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
19	PDB:4g1eB	0.090	0.087	7.530E-4	709	0.074	0.072	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
20	PDB:5a50A	0.144	0.524	8.902E-4	165	0.023	0.097	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O00548	0.0	635	723	0.515	0.488	DLL1_HUMAN Delta-like protein 1 OS=Homo sapiens OX=9606 GN=DLL1 PE=1 SV=2
2	O57409	0.0	534	615	0.404	0.450	DLLB_DANRE Delta-like protein B OS=Danio rerio OX=7955 GN=dlb PE=1 SV=1
3	P97677	0.0	634	714	0.521	0.500	DLL1_RAT Delta-like protein 1 OS=Rattus norvegicus OX=10116 GN=Dll1 PE=1 SV=1
4	Q1ECY3	0.0	732	683	0.564	0.565	Q1ECY3_DANRE Delta-like protein OS=Danio rerio OX=7955 GN=zgc:136596 PE=2 SV=1
5	Q61483	0.0	623	722	0.518	0.492	DLL1_MOUSE Delta-like protein 1 OS=Mus musculus OX=10090 GN=Dll1 PE=1 SV=2
6	Q6DI48	0.0	556	772	0.448	0.398	DLLA_DANRE Delta-like protein A OS=Danio rerio OX=7955 GN=dla PE=1 SV=1
7	Q8UWJ4	0.0	602	717	0.491	0.469	DLLD_DANRE Delta-like protein D OS=Danio rerio OX=7955 GN=dld PE=1 SV=2
8	Q90656	0.0	645	728	0.508	0.478	Q90656_CHICK Delta-like protein OS=Gallus gallus OX=9031 PE=2 SV=1
9	Q9IAT6	0.0	577	664	0.451	0.465	DLLC_DANRE Delta-like protein C OS=Danio rerio OX=7955 GN=dlc PE=2 SV=1
10	Q9JI71	0.0	1163	686	0.860	0.859	DLL4_MOUSE Delta-like protein 4 OS=Mus musculus OX=10090 GN=Dll4 PE=1 SV=2
11	Q9NR61	0.0	1402	685	1.000	1.000	DLL4_HUMAN Delta-like protein 4 OS=Homo sapiens OX=9606 GN=DLL4 PE=1 SV=1
12	P10041	1.20e-144	444	833	0.366	0.301	DL_DROME Neurogenic locus protein delta OS=Drosophila melanogaster OX=7227 GN=Delta PE=1 SV=2
13	Q9QXX0	2.37e-127	408	1218	0.304	0.171	JAG1_MOUSE Protein jagged-1 OS=Mus musculus OX=10090 GN=Jag1 PE=1 SV=1
14	Q63722	2.48e-127	408	1219	0.304	0.171	JAG1_RAT Protein jagged-1 OS=Rattus norvegicus OX=10116 GN=Jag1 PE=1 SV=2
15	P78504	6.83e-127	407	1218	0.304	0.171	JAG1_HUMAN Protein jagged-1 OS=Homo sapiens OX=9606 GN=JAG1 PE=1 SV=3
16	Q90Y54	8.48e-126	404	1213	0.314	0.177	JAG1B_DANRE Protein jagged-1b OS=Danio rerio OX=7955 GN=jag1b PE=2 SV=1
17	Q9Y219	1.62e-123	398	1238	0.328	0.182	JAG2_HUMAN Protein jagged-2 OS=Homo sapiens OX=9606 GN=JAG2 PE=1 SV=3
18	Q90Y56	9.88e-122	394	1254	0.311	0.170	Q90Y56_DANRE Delta-like protein OS=Danio rerio OX=7955 GN=jag2 PE=2 SV=1
19	Q9QYE5	2.60e-119	387	1247	0.314	0.172	JAG2_MOUSE Protein jagged-2 OS=Mus musculus OX=10090 GN=Jag2 PE=2 SV=2
20	Q90Y57	3.70e-119	387	1242	0.308	0.170	JAG1A_DANRE Protein jagged-1a OS=Danio rerio OX=7955 GN=jag1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12253 CAF1A	7.8e+02	11.7	Chromatin assembly factor 1 subunit A
2	PF01414 DSL	6.3e-16	69.7	Delta serrate ligand
3	PF14316 DUF4381	23	16.7	Domain of unknown function (DUF4381)
4	PF00008 EGF	3.2e-29	112.2	EGF-like domain
5	PF07974 EGF_2	5.3e-08	44.4	EGF-like domain
6	PF12947 EGF_3	2.5	19.7	EGF domain
7	PF07645 EGF_CA	84	14.8	Calcium-binding EGF domain
8	PF12661 hEGF	1.1e-17	75.1	Human growth factor-like EGF
9	PF00053 Laminin_EGF	2.7e+02	13.1	Laminin EGF domain
10	PF07657 MNNL	1.7e-36	136.6	N terminus of Notch ligand C2-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000249749

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358815	0.986	E3 ubiquitin-protein ligase NEURL1B
2	9606.ENSP00000261537	0.984	E3 ubiquitin-protein ligase MIB1
3	9606.ENSP00000358795	0.981	E3 ubiquitin-protein ligase NEURL1
4	9606.ENSP00000260408	0.972	Disintegrin and metalloproteinase domain-containing protein 10
5	9606.ENSP00000263388	0.956	Neurogenic locus notch homolog protein 3
6	9606.ENSP00000256646	0.955	Neurogenic locus notch homolog protein 2
7	9606.ENSP00000364163	0.949	Neurogenic locus notch homolog protein 4
8	9606.ENSP00000309968	0.947	Disintegrin and metalloproteinase domain-containing protein 17
9	9606.ENSP00000294785	0.946	Nicastrin
10	9606.ENSP00000328169	0.944	Protein jagged-2
11	9606.ENSP00000254958	0.941	Protein jagged-1
12	9606.ENSP00000426103	0.936	E3 ubiquitin-protein ligase MIB2
13	9606.ENSP00000358105	0.932	Gamma-secretase subunit APH-1A
14	9606.ENSP00000468411	0.930	Gamma-secretase subunit PEN-2
15	9606.ENSP00000261879	0.922	Gamma-secretase subunit APH-1B
16	9606.ENSP00000355718	0.909	Delta-like protein 1
17	9606.ENSP00000357348	0.872	Hairy/enhancer-of-split related with YRPW motif protein 2
18	9606.ENSP00000338272	0.869	Hairy/enhancer-of-split related with YRPW motif protein 1
19	9606.ENSP00000345206	0.862	Recombining binding protein suppressor of hairless
20	9606.ENSP00000277541	0.858	Neurogenic locus notch homolog protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005112	1.000	Notch binding
GO:0048018	1.000	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.992	regulation of cellular process
GO:0048731	0.985	system development
GO:0048513	0.984	animal organ development
GO:0050896	0.982	response to stimulus
GO:0007154	0.980	cell communication
GO:0023052	0.979	signaling
GO:0048519	0.977	negative regulation of biological process
GO:0051716	0.968	cellular response to stimulus
GO:0048523	0.956	negative regulation of cellular process
GO:0007219	0.942	Notch signaling pathway
GO:0030154	0.939	cell differentiation
GO:0031323	0.923	regulation of cellular metabolic process
GO:0030336	0.903	negative regulation of cell migration
GO:0051171	0.876	regulation of nitrogen compound metabolic process
GO:0009653	0.872	anatomical structure morphogenesis
GO:0010594	0.868	regulation of endothelial cell migration
GO:0010633	0.867	negative regulation of epithelial cell migration
GO:0048518	0.865	positive regulation of biological process
GO:0008593	0.862	regulation of Notch signaling pathway
GO:0010596	0.856	negative regulation of endothelial cell migration
GO:0042127	0.848	regulation of cell population proliferation
GO:0051093	0.842	negative regulation of developmental process
GO:0060255	0.838	regulation of macromolecule metabolic process
GO:0048522	0.837	positive regulation of cellular process
GO:0080090	0.821	regulation of primary metabolic process
GO:0043535	0.820	regulation of blood vessel endothelial cell migration
GO:0007507	0.814	heart development
GO:0045596	0.802	negative regulation of cell differentiation
GO:0001568	0.794	blood vessel development
GO:0007399	0.781	nervous system development
GO:0010468	0.775	regulation of gene expression
GO:0035239	0.755	tube morphogenesis
GO:0001936	0.747	regulation of endothelial cell proliferation
GO:0009892	0.739	negative regulation of metabolic process
GO:0009893	0.707	positive regulation of metabolic process
GO:0007417	0.694	central nervous system development
GO:2000026	0.690	regulation of multicellular organismal development
GO:0048514	0.690	blood vessel morphogenesis
GO:0071363	0.676	cellular response to growth factor stimulus
GO:0009889	0.673	regulation of biosynthetic process
GO:0009888	0.647	tissue development
GO:0010604	0.627	positive regulation of macromolecule metabolic process
GO:0010605	0.623	negative regulation of macromolecule metabolic process
GO:0048646	0.616	anatomical structure formation involved in morphogenesis
GO:0010556	0.549	regulation of macromolecule biosynthetic process
GO:0031326	0.545	regulation of cellular biosynthetic process
GO:0019219	0.543	regulation of nucleobase-containing compound metabolic process
GO:0021514	0.530	ventral spinal cord interneuron differentiation
GO:0048584	0.527	positive regulation of response to stimulus
GO:0023056	0.519	positive regulation of signaling
GO:0010647	0.519	positive regulation of cell communication
GO:0008285	0.513	negative regulation of cell population proliferation
GO:1905314	0.507	semi-lunar valve development
GO:0009967	0.494	positive regulation of signal transduction
GO:0006355	0.461	regulation of DNA-templated transcription
GO:0008284	0.442	positive regulation of cell population proliferation
GO:0009887	0.398	animal organ morphogenesis
GO:0045165	0.386	cell fate commitment
GO:0031325	0.359	positive regulation of cellular metabolic process
GO:0051173	0.337	positive regulation of nitrogen compound metabolic process
GO:0007389	0.335	pattern specification process
GO:0003002	0.314	regionalization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.816	intracellular anatomical structure
GO:0005737	0.675	cytoplasm
GO:0043231	0.356	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]