StarFunc result for job id Q9NR82

User Input

>input (932 residues)
MPRHHAGGEEGGAAGLWVKSGAAAAAAGGGRLGSGMKDVESGRGRVLLNSAAARGDGLLL
LGTRAATLGGGGGGLRESRRGKQGARMSLLGKPLSYTSSQSCRRNVKYRRVQNYLYNVLE
RPRGWAFIYHAFVFLLVFGCLILSVFSTIPEHTKLASSCLLILEFVMIVVFGLEFIIRIW
SAGCCCRYRGWQGRLRFARKPFCVIDTIVLIASIAVVSAKTQGNIFATSALRSLRFLQIL
RMVRMDRRGGTWKLLGSVVYAHSKELITAWYIGFLVLIFSSFLVYLVEKDANKEFSTYAD
ALWWGTITLTTIGYGDKTPLTWLGRLLSAGFALLGISFFALPAGILGSGFALKVQEQHRQ
KHFEKRRNPAANLIQCVWRSYAADEKSVSIATWKPHLKALHTCSPTKKEQGEASSSQKLS
FKERVRMASPRGQSIKSRQASVGDRRSPSTDITAEGSPTKVQKSWSFNDRTRFRPSLRLK
SSQPKPVIDADTALGTDDVYDEKGCQCDVSVEDLTPPLKTVIRAIRIMKFHVAKRKFKET
LRPYDVKDVIEQYSAGHLDMLCRIKSLQTRVDQILGKGQITSDKKSREKITAEHETTDDL
SMLGRVVKVEKQVQSIESKLDCLLDIYQQVLRKGSASALALASFQIPPFECEQTSDYQSP
VDSKDLSGSAQNSGCLSRSTSANISRGLQFILTPNEFSAQTFYALSPTMHSQATQVPISQ
SDGSAVAATNTIANQINTAPKPAAPTTLQIPPPLPAIKHLPRPETLHPNPAGLQESISDV
TTCLVASKENVQVAQSNLTKDRSMRKSFDMGGETLLSVCPMVPKDLGKSLSVQNLIRSTE
ELNIQLSGSESSGSRGSQDFYPKWRESKLFITDEEVGPEETETDTFDAAPQPAREAAFAS
DSLRTGRSRSSQSICKAGESTDALSLPHVKLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9JK45	0.848	0.847	0.000	933	0.957	0.956	Q9JK45.pdb.gz	KCNQ5_MOUSE Potassium voltage-gated channel subfamily KQT member 5 OS=Mus musculus OX=10090 GN=Kcnq5 PE=1 SV=2
2	AFDB:F1LY25	0.440	0.495	6.018E-85	821	0.813	0.923	F1LY25.pdb.gz	F1LY25_RAT Potassium voltage-gated channel subfamily Q member 5 OS=Rattus norvegicus OX=10116 GN=Kcnq5 PE=1 SV=4
3	AFDB:O88943	0.458	0.498	4.582E-53	852	0.445	0.487	O88943.pdb.gz	KCNQ2_RAT Potassium voltage-gated channel subfamily KQT member 2 OS=Rattus norvegicus OX=10116 GN=Kcnq2 PE=1 SV=1
4	AFDB:A0A0B4KEH2	0.434	0.479	6.332E-46	839	0.340	0.378	A0A0B4KEH2.pdb.gz	A0A0B4KEH2_DROME KCNQ potassium channel, isoform I OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
5	AFDB:P97414	0.418	0.571	1.369E-35	668	0.274	0.382	P97414.pdb.gz	KCNQ1_MOUSE Potassium voltage-gated channel subfamily KQT member 1 OS=Mus musculus OX=10090 GN=Kcnq1 PE=1 SV=3
6	AFDB:P51787	0.414	0.559	1.582E-35	676	0.270	0.373	P51787.pdb.gz	KCNQ1_HUMAN Potassium voltage-gated channel subfamily KQT member 1 OS=Homo sapiens OX=9606 GN=KCNQ1 PE=1 SV=3
7	PDB:7bylA	0.338	0.816	2.232E-33	354	0.310	0.816	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
8	PDB:7vnrA	0.333	0.885	7.220E-29	333	0.303	0.847	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.
9	AFDB:Q92953	0.238	0.243	9.965E-13	911	0.152	0.156	Q92953.pdb.gz	KCNB2_HUMAN Potassium voltage-gated channel subfamily B member 2 OS=Homo sapiens OX=9606 GN=KCNB2 PE=1 SV=2
10	PDB:7f3fA	0.241	0.450	4.703E-9	460	0.068	0.137	7f3fA.pdb.gz
11	PDB:7w6sB	0.232	0.440	6.584E-9	448	0.067	0.138	7w6sB.pdb.gz
12	PDB:7phhA	0.226	0.490	2.098E-7	396	0.064	0.152	7phhA.pdb.gz
13	PDB:7sizB	0.215	0.550	3.393E-7	334	0.063	0.177	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
14	PDB:7sszA	0.222	0.525	4.984E-7	362	0.070	0.180	7sszA.pdb.gz
15	PDB:3lutB	0.205	0.448	1.025E-6	390	0.065	0.156	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
16	AFDB:P27884	0.200	0.092	2.325E-6	2424	0.137	0.053	P27884.pdb.gz	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
17	PDB:6eo1A	0.195	0.461	3.113E-5	355	0.058	0.152	6eo1A.pdb.gz
18	AFDB:A0A1D8PSN1	0.076	0.089	1.760E-4	750	0.084	0.104	A0A1D8PSN1.pdb.gz	A0A1D8PSN1_CANAL Transcription initiation factor TFIID subunit 12 domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TAF12L PE=3 SV=1
19	PDB:7pquA	0.193	0.495	1.934E-4	328	0.062	0.177	7pquA.pdb.gz
20	AFDB:Q21227	0.074	0.066	3.288E-4	1188	0.143	0.112	Q21227.pdb.gz	APR1_CAEEL Adenomatous polyposis coli protein-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=apr-1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZNI9	0.0	1671	923	0.940	0.949	A0A8I5ZNI9_RAT Potassium voltage-gated channel subfamily Q member 5 OS=Rattus norvegicus OX=10116 GN=Kcnq5 PE=4 SV=1
2	A0A8I5ZXW9	0.0	1696	932	0.950	0.950	A0A8I5ZXW9_RAT Potassium voltage-gated channel subfamily Q member 5 OS=Rattus norvegicus OX=10116 GN=Kcnq5 PE=4 SV=1
3	A0A8I6AWB8	0.0	748	822	0.398	0.451	A0A8I6AWB8_RAT Potassium voltage-gated channel subfamily Q member 5 OS=Rattus norvegicus OX=10116 GN=Kcnq5 PE=4 SV=1
4	F1LY25	0.0	1686	951	0.950	0.931	F1LY25_RAT Potassium voltage-gated channel subfamily Q member 5 OS=Rattus norvegicus OX=10116 GN=Kcnq5 PE=1 SV=4
5	O43525	0.0	617	872	0.355	0.380	KCNQ3_HUMAN Potassium voltage-gated channel subfamily KQT member 3 OS=Homo sapiens OX=9606 GN=KCNQ3 PE=1 SV=2
6	O43526	0.0	698	872	0.408	0.436	KCNQ2_HUMAN Potassium voltage-gated channel subfamily KQT member 2 OS=Homo sapiens OX=9606 GN=KCNQ2 PE=1 SV=2
7	O88943	0.0	711	852	0.417	0.457	KCNQ2_RAT Potassium voltage-gated channel subfamily KQT member 2 OS=Rattus norvegicus OX=10116 GN=Kcnq2 PE=1 SV=1
8	O88944	0.0	613	873	0.351	0.375	KCNQ3_RAT Potassium voltage-gated channel subfamily KQT member 3 OS=Rattus norvegicus OX=10116 GN=Kcnq3 PE=1 SV=2
9	P56696	0.0	775	695	0.428	0.574	KCNQ4_HUMAN Potassium voltage-gated channel subfamily KQT member 4 OS=Homo sapiens OX=9606 GN=KCNQ4 PE=1 SV=2
10	Q8K3F6	0.0	614	873	0.359	0.384	KCNQ3_MOUSE Potassium voltage-gated channel subfamily KQT member 3 OS=Mus musculus OX=10090 GN=Kcnq3 PE=1 SV=2
11	Q9JK45	0.0	1718	933	0.955	0.954	KCNQ5_MOUSE Potassium voltage-gated channel subfamily KQT member 5 OS=Mus musculus OX=10090 GN=Kcnq5 PE=1 SV=2
12	Q9JK97	0.0	763	696	0.421	0.563	KCNQ4_MOUSE Potassium voltage-gated channel subfamily KQT member 4 OS=Mus musculus OX=10090 GN=Kcnq4 PE=2 SV=2
13	Q9NR82	0.0	1919	932	1.000	1.000	KCNQ5_HUMAN Potassium voltage-gated channel subfamily KQT member 5 OS=Homo sapiens OX=9606 GN=KCNQ5 PE=1 SV=3
14	Q9Z351	0.0	693	759	0.411	0.505	KCNQ2_MOUSE Potassium voltage-gated channel subfamily KQT member 2 OS=Mus musculus OX=10090 GN=Kcnq2 PE=1 SV=1
15	A0A0B4KEI9	2.57e-173	526	823	0.302	0.341	A0A0B4KEI9_DROME KCNQ potassium channel, isoform H OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
16	B7YZR4	5.77e-172	518	683	0.303	0.413	B7YZR4_DROME KCNQ potassium channel, isoform C OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
17	Q8IT87	1.45e-171	515	649	0.302	0.433	Q8IT87_DROME Potassium channel OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=2 SV=1
18	A0A0B4KFJ4	5.13e-171	519	781	0.303	0.361	A0A0B4KFJ4_DROME KCNQ potassium channel, isoform K OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
19	B7YZR3	5.49e-171	518	774	0.302	0.363	B7YZR3_DROME KCNQ potassium channel, isoform D OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
20	A0A0B4KF62	5.66e-171	520	805	0.303	0.350	A0A0B4KF62_DROME KCNQ potassium channel, isoform G OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF20136 DUF6526	3.5e+02	12.7	Family of unknown function (DUF6526)
2	PF00520 Ion_trans	1.7e-22	91.5	Ion transport protein
3	PF07885 Ion_trans_2	6.3e-11	53.4	Ion channel
4	PF03520 KCNQ_channel	2.1e-92	319.5	KCNQ voltage-gated potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003809584.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008953746.1	0.919	Belongs to the potassium channel family.
2	9597.XP_008960521.1	0.863	Belongs to the potassium channel family.
3	9597.XP_003831673.1	0.860	Potassium voltage-gated channel subfamily H member 5
4	9597.XP_008967333.1	0.859	Belongs to the potassium channel family.
5	9597.XP_008966666.1	0.842	Potassium voltage-gated channel subfamily KQT member 4
6	9597.XP_003808994.1	0.833	Potassium voltage-gated channel subfamily J member 2
7	9597.XP_003821638.1	0.825	Potassium voltage-gated channel subfamily J member 4
8	9597.XP_008964959.1	0.825	Potassium voltage-gated channel subfamily J member 14
9	9597.XP_008975934.1	0.799	Potassium voltage-gated channel subfamily E member 1 isoform X1
10	9597.XP_003824018.1	0.762	Potassium voltage-gated channel subfamily E member 2
11	9597.XP_003814729.1	0.727	Potassium voltage-gated channel subfamily E member 3
12	9597.XP_003828658.1	0.725	Ubiquitin-like protein fubi and ribosomal protein S30
13	9597.XP_003818724.1	0.722	Potassium voltage-gated channel subfamily E regulatory subunit 4
14	9597.XP_003820378.1	0.711	Potassium voltage-gated channel subfamily A member 1
15	9597.XP_008949579.1	0.700	Potassium voltage-gated channel subfamily S member 1
16	9597.XP_003830698.1	0.689	Potassium voltage-gated channel subfamily A member regulatory beta subunit 1
17	9597.XP_008973972.1	0.689	Potassium voltage-gated channel subfamily A regulatory beta subunit 2
18	9597.XP_003830475.1	0.684	Potassium voltage-gated channel subfamily A member 4
19	9597.XP_008961313.1	0.684	Potassium voltage-gated channel subfamily C member 4
20	9597.XP_003810710.1	0.674	Potassium voltage-gated channel subfamily A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005249	1.000	voltage-gated potassium channel activity
GO:0005515	0.948	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006811	0.995	monoatomic ion transport
GO:0006813	0.986	potassium ion transport
GO:0009987	0.828	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0030424	0.969	axon
GO:0032991	0.962	protein-containing complex
GO:0030054	0.954	cell junction
GO:0005622	0.913	intracellular anatomical structure
GO:0098590	0.909	plasma membrane region
GO:0044306	0.904	neuron projection terminus
GO:0098793	0.900	presynapse
GO:0005737	0.867	cytoplasm
GO:0150034	0.847	distal axon
GO:0044305	0.835	calyx of Held
GO:0098796	0.811	membrane protein complex
GO:0042734	0.809	presynaptic membrane
GO:0098797	0.749	plasma membrane protein complex
GO:0043231	0.740	intracellular membrane-bounded organelle
GO:1990351	0.604	transporter complex
GO:1902495	0.563	transmembrane transporter complex
GO:0034702	0.525	ion channel complex
GO:0034703	0.524	cation channel complex
GO:0008076	0.436	voltage-gated potassium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]