StarFunc result for job id Q9NR96

User Input

>input (1032 residues)
MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAA
PRGNVTSLSLSSNRIHHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNNIMTVPALPKSLISLSLSHTNILMLDSASLAGLHALRFLFMDGNCYY
KNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIVKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMGEADGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRL
RDNYLAFFKWWSLHFLPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGF
FSKAKELRELNLSANALKTVDHSWFGPLASALQILDVSANPLHCACGAAFMDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLAVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0RAA8	0.839	0.839	0.000	1032	0.740	0.740	M0RAA8.pdb.gz	M0RAA8_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=3 SV=1
2	AFDB:Q2EEY0	0.781	0.782	0.000	1031	0.841	0.842	Q2EEY0.pdb.gz	TLR9_HORSE Toll-like receptor 9 OS=Equus caballus OX=9796 GN=TLR9 PE=1 SV=1
3	AFDB:Q5I2M5	0.813	0.815	0.000	1029	0.791	0.793	Q5I2M5.pdb.gz	TLR9_BOVIN Toll-like receptor 9 OS=Bos taurus OX=9913 GN=TLR9 PE=1 SV=1
4	AFDB:Q9EQU3	0.798	0.798	0.000	1032	0.754	0.754	Q9EQU3.pdb.gz	TLR9_MOUSE Toll-like receptor 9 OS=Mus musculus OX=10090 GN=Tlr9 PE=1 SV=3
5	AFDB:Q9NR96	1.000	1.000	0.000	1032	1.000	1.000	Q9NR96.pdb.gz	TLR9_HUMAN Toll-like receptor 9 OS=Homo sapiens OX=9606 GN=TLR9 PE=1 SV=2
6	AFDB:P58681	0.716	0.704	9.887E-79	1050	0.359	0.353	P58681.pdb.gz	TLR7_MOUSE Toll-like receptor 7 OS=Mus musculus OX=10090 GN=Tlr7 PE=1 SV=1
7	AFDB:Q5ZJD0	0.737	0.719	3.782E-77	1059	0.372	0.363	Q5ZJD0.pdb.gz	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
8	AFDB:A0A2R8QA47	0.720	0.696	4.343E-77	1069	0.388	0.374	A0A2R8QA47.pdb.gz
9	AFDB:Q9NYK1	0.740	0.729	4.763E-77	1049	0.363	0.357	Q9NYK1.pdb.gz	TLR7_HUMAN Toll-like receptor 7 OS=Homo sapiens OX=9606 GN=TLR7 PE=1 SV=1
10	AFDB:A8SZH4	0.728	0.700	1.661E-75	1074	0.369	0.355	A8SZH4.pdb.gz	A8SZH4_SALSA Toll-like receptor 9 OS=Salmo salar OX=8030 GN=TLR9 PE=2 SV=1
11	PDB:3j0aA	0.317	0.391	1.040E-21	797	0.167	0.216	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7wv3A	0.429	0.616	5.028E-19	668	0.162	0.250	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:6gffI	0.334	0.560	3.517E-16	551	0.160	0.299	6gffI.pdb.gz
14	PDB:3t6qA	0.391	0.604	3.857E-16	601	0.150	0.258	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:3b2dA	0.391	0.605	1.114E-15	601	0.148	0.255	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:7wrqA	0.293	0.479	1.618E-14	566	0.166	0.302	7wrqA.pdb.gz
17	PDB:7tvfD	0.284	0.500	2.252E-12	515	0.122	0.245	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
18	PDB:7p5vB	0.255	0.344	6.024E-8	732	0.084	0.119	7p5vB.pdb.gz
19	PDB:1xcdA	0.217	0.681	1.001E-7	305	0.065	0.220	1xcdA.pdb.gz
20	PDB:6m04A	0.231	0.312	1.382E-7	714	0.078	0.112	6m04A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8SZH4	0.0	578	1074	0.377	0.362	A8SZH4_SALSA Toll-like receptor 9 OS=Salmo salar OX=8030 GN=TLR9 PE=2 SV=1
2	B3DJW3	0.0	603	1057	0.388	0.378	B3DJW3_DANRE Toll-like receptor 9 OS=Danio rerio OX=7955 GN=sb:eu392 PE=2 SV=1
3	M0RAA8	0.0	1504	1032	0.742	0.742	M0RAA8_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=3 SV=1
4	P58681	0.0	565	1050	0.360	0.354	TLR7_MOUSE Toll-like receptor 7 OS=Mus musculus OX=10090 GN=Tlr7 PE=1 SV=1
5	Q2EEY0	0.0	1734	1031	0.841	0.842	TLR9_HORSE Toll-like receptor 9 OS=Equus caballus OX=9796 GN=TLR9 PE=1 SV=1
6	Q5GQ97	0.0	617	1046	0.369	0.364	Q5GQ97_CHICK Toll-like receptor 7 (Fragment) OS=Gallus gallus OX=9031 GN=TLR7 PE=3 SV=1
7	Q5I2M5	0.0	1561	1029	0.790	0.792	TLR9_BOVIN Toll-like receptor 9 OS=Bos taurus OX=9913 GN=TLR9 PE=1 SV=1
8	Q5ZJD0	0.0	616	1059	0.369	0.360	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
9	Q6Y1S0	0.0	1499	1032	0.739	0.739	Q6Y1S0_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=2 SV=1
10	Q80XA5	0.0	588	388	0.289	0.768	Q80XA5_RAT Toll-like receptor 9 (Fragment) OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=2 SV=1
11	Q9EQU3	0.0	1513	1032	0.755	0.755	TLR9_MOUSE Toll-like receptor 9 OS=Mus musculus OX=10090 GN=Tlr9 PE=1 SV=3
12	Q9NR96	0.0	2094	1032	1.000	1.000	TLR9_HUMAN Toll-like receptor 9 OS=Homo sapiens OX=9606 GN=TLR9 PE=1 SV=2
13	Q9NYK1	1.93e-178	550	1049	0.359	0.353	TLR7_HUMAN Toll-like receptor 7 OS=Homo sapiens OX=9606 GN=TLR7 PE=1 SV=1
14	P58682	1.89e-177	546	1032	0.340	0.340	TLR8_MOUSE Toll-like receptor 8 OS=Mus musculus OX=10090 GN=Tlr8 PE=1 SV=2
15	Q9NR97	4.38e-174	538	1041	0.350	0.347	TLR8_HUMAN Toll-like receptor 8 OS=Homo sapiens OX=9606 GN=TLR8 PE=1 SV=1
16	Q6R5N8	3.00e-49	192	991	0.253	0.263	TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus OX=10090 GN=Tlr13 PE=1 SV=1
17	A0A2R8RTN4	2.07e-46	183	955	0.252	0.272	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1
18	Q5ZJ34	2.79e-46	182	972	0.268	0.285	Q5ZJ34_CHICK TIR domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_21a21 PE=2 SV=1
19	C0LP03	7.11e-46	181	859	0.225	0.270	C0LP03_RAT Toll-like receptor 5 OS=Rattus norvegicus OX=10116 GN=Tlr5 PE=2 SV=1
20	G3V6F8	1.70e-45	179	871	0.225	0.266	G3V6F8_RAT Toll-like receptor 5 OS=Rattus norvegicus OX=10116 GN=Tlr5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05725 FNIP	6.7e+02	11.9	FNIP Repeat
2	PF00560 LRR_1	6.8e-15	64.1	Leucine Rich Repeat
3	PF18837 LRR_12	3.7e-15	66.6	Leucine-rich repeat
4	PF12799 LRR_4	1.9e-47	169.5	Leucine Rich repeats (2 copies)
5	PF13306 LRR_5	0.25	22.7	BspA type Leucine rich repeat region (6 copies)
6	PF13516 LRR_6	1.7e-06	38.7	Leucine Rich repeat
7	PF13855 LRR_8	8.6e-87	296.2	Leucine rich repeat
8	PF14580 LRR_9	0.012	26.7	Leucine-rich repeat
9	PF01582 TIR	0.0019	29.5	TIR domain
10	PF13676 TIR_2	1.6e+02	14.3	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000417517

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.996	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000227471	0.995	Protein unc-93 homolog B1
3	9606.ENSP00000271450	0.897	Low affinity immunoglobulin gamma Fc region receptor II-a
4	9606.ENSP00000433623	0.889	TNF receptor-associated factor 6
5	9606.ENSP00000345347	0.888	High mobility group protein B1
6	9606.ENSP00000361359	0.865	Tumor necrosis factor receptor superfamily member 5
7	9606.ENSP00000358997	0.859	Interleukin-1 receptor-associated kinase 1
8	9606.ENSP00000276927	0.856	Interferon alpha-1/13
9	9606.ENSP00000380697	0.856	Interferon regulatory factor 7
10	9606.ENSP00000398698	0.852	Tumor necrosis factor
11	9606.ENSP00000385675	0.842	Interleukin-6
12	9606.ENSP00000369581	0.838	Interferon beta
13	9606.ENSP00000390651	0.838	Interleukin-1 receptor-associated kinase 4
14	9606.ENSP00000412237	0.826	Interleukin-10
15	9606.ENSP00000011653	0.797	T-cell surface glycoprotein CD4
16	9606.ENSP00000376445	0.797	Toll/interleukin-1 receptor domain-containing adapter protein
17	9606.ENSP00000329967	0.785	Serine/threonine-protein kinase TBK1
18	9606.ENSP00000369213	0.777	Probable ATP-dependent RNA helicase DDX58
19	9606.ENSP00000263341	0.768	Interleukin-1 beta
20	9606.ENSP00000471896	0.759	Interferon regulatory factor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003676	1.000	nucleic acid binding
GO:0003677	0.994	DNA binding
GO:0043565	0.967	sequence-specific DNA binding
GO:0003723	0.905	RNA binding
GO:0038023	0.698	signaling receptor activity
GO:0005102	0.545	signaling receptor binding
GO:0045322	0.455	unmethylated CpG binding
GO:0042802	0.345	identical protein binding
GO:0038187	0.313	pattern recognition receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.993	positive regulation of biological process
GO:0048583	0.989	regulation of response to stimulus
GO:0009987	0.987	cellular process
GO:0050896	0.986	response to stimulus
GO:0019222	0.985	regulation of metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0080134	0.982	regulation of response to stress
GO:0032101	0.982	regulation of response to external stimulus
GO:0048584	0.981	positive regulation of response to stimulus
GO:0048522	0.980	positive regulation of cellular process
GO:0031347	0.966	regulation of defense response
GO:0080090	0.959	regulation of primary metabolic process
GO:0051171	0.959	regulation of nitrogen compound metabolic process
GO:0010468	0.959	regulation of gene expression
GO:0002376	0.957	immune system process
GO:0062207	0.951	regulation of pattern recognition receptor signaling pathway
GO:0051092	0.948	positive regulation of NF-kappaB transcription factor activity
GO:0051716	0.935	cellular response to stimulus
GO:0039531	0.930	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0002253	0.926	activation of immune response
GO:0032103	0.924	positive regulation of response to external stimulus
GO:0031349	0.923	positive regulation of defense response
GO:0045089	0.910	positive regulation of innate immune response
GO:0023052	0.907	signaling
GO:0002218	0.887	activation of innate immune response
GO:0062208	0.883	positive regulation of pattern recognition receptor signaling pathway
GO:0007165	0.877	signal transduction
GO:1902531	0.774	regulation of intracellular signal transduction
GO:0006950	0.762	response to stress
GO:0051240	0.759	positive regulation of multicellular organismal process
GO:0010604	0.753	positive regulation of macromolecule metabolic process
GO:0006952	0.747	defense response
GO:0043207	0.735	response to external biotic stimulus
GO:0010628	0.733	positive regulation of gene expression
GO:0051707	0.732	response to other organism
GO:0001819	0.718	positive regulation of cytokine production
GO:0031325	0.691	positive regulation of cellular metabolic process
GO:0098542	0.637	defense response to other organism
GO:0042221	0.542	response to chemical
GO:0048519	0.484	negative regulation of biological process
GO:0048523	0.474	negative regulation of cellular process
GO:0051173	0.472	positive regulation of nitrogen compound metabolic process
GO:0032501	0.416	multicellular organismal process
GO:0010033	0.402	response to organic substance
GO:0006955	0.393	immune response
GO:0070887	0.390	cellular response to chemical stimulus
GO:0071704	0.341	organic substance metabolic process
GO:0051246	0.333	regulation of protein metabolic process
GO:1902533	0.324	positive regulation of intracellular signal transduction
GO:0044238	0.316	primary metabolic process
GO:0032502	0.310	developmental process
GO:0006807	0.307	nitrogen compound metabolic process
GO:0071310	0.306	cellular response to organic substance
GO:0002764	0.305	immune response-regulating signaling pathway
GO:0002757	0.302	immune response-activating signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.967	intracellular anatomical structure
GO:0005737	0.963	cytoplasm
GO:0012505	0.942	endomembrane system
GO:0043226	0.875	organelle
GO:0043227	0.848	membrane-bounded organelle
GO:0043231	0.742	intracellular membrane-bounded organelle
GO:0031982	0.607	vesicle
GO:0031410	0.365	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]