StarFunc result for job id Q9NR97

User Input

>input (1041 residues)
MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECSNRRLQEVPQT
VGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNVQHQNGNPGIQSNGLNITDGA
FLNLKNLRELLLEDNQLPQIPSGLPESLTELSLIQNNIYNITKEGISRLINLKNLYLAWN
CYFNKVCEKTNIEDGVFETLTNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEE
DFKGLINLTLLDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR
KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIKGSYPQHINIS
RNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTINLGINFIKQIDFKLFQNFSNL
EIIYLSENRISPLVKDTRQSYANSSSFQRHIRKRRSTDFEFDPHSNFYHFTRPLIKPQCA
AYGKALDLSLNSIFFIGPNQFENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNN
RLDFDNASALTELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT
DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNRLKHIPNEAFL
NLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKLLFLTDSLSDFTSSLRTLLLS
HNRISHLPSGFLSEVSSLKHLDLSSNLLKTINKSALETKTTTKLSMLELHGNPFECTCDI
GDFRRWMDEHLNVKIPRLVDVICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITT
MVMLAALAHHLFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE
LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKYAKSWNFKTAF
YLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSSILQWPDNPKAEGLFWQTLRN
VVLTENDSRYNNMYVDSIKQY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P58682	0.779	0.785	0.000	1032	0.699	0.705	P58682.pdb.gz	TLR8_MOUSE Toll-like receptor 8 OS=Mus musculus OX=10090 GN=Tlr8 PE=1 SV=2
2	AFDB:Q9NR97	1.000	1.000	0.000	1041	1.000	1.000	Q9NR97.pdb.gz	TLR8_HUMAN Toll-like receptor 8 OS=Homo sapiens OX=9606 GN=TLR8 PE=1 SV=1
3	AFDB:Q9NYK1	0.801	0.795	8.808E-92	1049	0.425	0.421	Q9NYK1.pdb.gz	TLR7_HUMAN Toll-like receptor 7 OS=Homo sapiens OX=9606 GN=TLR7 PE=1 SV=1
4	AFDB:P58681	0.763	0.757	2.912E-91	1050	0.425	0.421	P58681.pdb.gz	TLR7_MOUSE Toll-like receptor 7 OS=Mus musculus OX=10090 GN=Tlr7 PE=1 SV=1
5	AFDB:Q5ZJD0	0.788	0.775	1.918E-90	1059	0.423	0.415	Q5ZJD0.pdb.gz	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
6	AFDB:A0A2R8QA47	0.772	0.752	3.285E-72	1069	0.345	0.336	A0A2R8QA47.pdb.gz
7	AFDB:A8SZH4	0.750	0.728	7.179E-72	1074	0.351	0.340	A8SZH4.pdb.gz	A8SZH4_SALSA Toll-like receptor 9 OS=Salmo salar OX=8030 GN=TLR9 PE=2 SV=1
8	AFDB:Q9NR96	0.740	0.746	2.468E-69	1032	0.342	0.345	Q9NR96.pdb.gz	TLR9_HUMAN Toll-like receptor 9 OS=Homo sapiens OX=9606 GN=TLR9 PE=1 SV=2
9	AFDB:Q5I2M5	0.741	0.749	4.080E-68	1029	0.336	0.340	Q5I2M5.pdb.gz	TLR9_BOVIN Toll-like receptor 9 OS=Bos taurus OX=9913 GN=TLR9 PE=1 SV=1
10	AFDB:Q9EQU3	0.840	0.847	2.567E-67	1032	0.347	0.350	Q9EQU3.pdb.gz	TLR9_MOUSE Toll-like receptor 9 OS=Mus musculus OX=10090 GN=Tlr9 PE=1 SV=3
11	PDB:3j0aA	0.267	0.321	1.172E-21	797	0.185	0.242	3j0aA.pdb.gz	Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
12	PDB:7wv3A	0.412	0.590	4.860E-20	668	0.170	0.265	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
13	PDB:3b2dA	0.357	0.544	4.206E-18	601	0.165	0.286	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
14	PDB:3t6qA	0.395	0.614	2.002E-16	601	0.155	0.268	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
15	PDB:6gffI	0.236	0.403	5.764E-16	551	0.162	0.307	6gffI.pdb.gz
16	PDB:7wrqA	0.286	0.482	1.504E-13	566	0.158	0.290	7wrqA.pdb.gz
17	PDB:7tvfD	0.201	0.309	4.331E-13	515	0.122	0.247	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.
18	PDB:1xcdA	0.205	0.660	1.627E-9	305	0.072	0.246	1xcdA.pdb.gz
19	PDB:5yq5B	0.179	0.486	3.544E-8	306	0.086	0.294	5yq5B.pdb.gz
20	PDB:7p5vB	0.238	0.324	1.284E-7	732	0.085	0.122	7p5vB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8SZH4	0.0	558	1074	0.353	0.342	A8SZH4_SALSA Toll-like receptor 9 OS=Salmo salar OX=8030 GN=TLR9 PE=2 SV=1
2	P58681	0.0	773	1050	0.422	0.418	TLR7_MOUSE Toll-like receptor 7 OS=Mus musculus OX=10090 GN=Tlr7 PE=1 SV=1
3	P58682	0.0	1472	1032	0.711	0.717	TLR8_MOUSE Toll-like receptor 8 OS=Mus musculus OX=10090 GN=Tlr8 PE=1 SV=2
4	Q5GQ97	0.0	802	1046	0.423	0.421	Q5GQ97_CHICK Toll-like receptor 7 (Fragment) OS=Gallus gallus OX=9031 GN=TLR7 PE=3 SV=1
5	Q5ZJD0	0.0	800	1059	0.422	0.415	Q5ZJD0_CHICK Toll-like receptor 7-long OS=Gallus gallus OX=9031 GN=RCJMB04_19d10 PE=2 SV=1
6	Q9NR96	0.0	559	1032	0.347	0.350	TLR9_HUMAN Toll-like receptor 9 OS=Homo sapiens OX=9606 GN=TLR9 PE=1 SV=2
7	Q9NR97	0.0	2126	1041	1.000	1.000	TLR8_HUMAN Toll-like receptor 8 OS=Homo sapiens OX=9606 GN=TLR8 PE=1 SV=1
8	Q9NYK1	0.0	776	1049	0.425	0.421	TLR7_HUMAN Toll-like receptor 7 OS=Homo sapiens OX=9606 GN=TLR7 PE=1 SV=1
9	Q2EEY0	1.93e-178	550	1031	0.341	0.344	TLR9_HORSE Toll-like receptor 9 OS=Equus caballus OX=9796 GN=TLR9 PE=1 SV=1
10	Q9EQU3	1.95e-177	547	1032	0.354	0.358	TLR9_MOUSE Toll-like receptor 9 OS=Mus musculus OX=10090 GN=Tlr9 PE=1 SV=3
11	M0RAA8	7.43e-175	540	1032	0.345	0.348	M0RAA8_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=3 SV=1
12	Q6Y1S0	3.65e-174	538	1032	0.344	0.347	Q6Y1S0_RAT Toll-like receptor 9 OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=2 SV=1
13	Q5I2M5	4.48e-169	525	1029	0.341	0.345	TLR9_BOVIN Toll-like receptor 9 OS=Bos taurus OX=9913 GN=TLR9 PE=1 SV=1
14	B3DJW3	2.53e-166	519	1057	0.345	0.340	B3DJW3_DANRE Toll-like receptor 9 OS=Danio rerio OX=7955 GN=sb:eu392 PE=2 SV=1
15	Q80XA5	1.70e-73	250	388	0.146	0.392	Q80XA5_RAT Toll-like receptor 9 (Fragment) OS=Rattus norvegicus OX=10116 GN=Tlr9 PE=2 SV=1
16	Q6R5N8	1.33e-54	209	991	0.252	0.264	TLR13_MOUSE Toll-like receptor 13 OS=Mus musculus OX=10090 GN=Tlr13 PE=1 SV=1
17	Q0PQ88	1.90e-49	192	896	0.232	0.269	Q0PQ88_CHICK Toll-like receptor 3 OS=Gallus gallus OX=9031 GN=TLR3 PE=2 SV=2
18	A0A2R8RTN4	1.34e-45	180	955	0.233	0.254	A0A2R8RTN4_DANRE Toll-like receptor 22 OS=Danio rerio OX=7955 GN=TLR21.2 PE=3 SV=1
19	Q5ZJ34	3.11e-42	170	972	0.214	0.229	Q5ZJ34_CHICK TIR domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_21a21 PE=2 SV=1
20	F8W4F1	9.78e-42	167	881	0.245	0.289	F8W4F1_DANRE Toll-like receptor 5 OS=Danio rerio OX=7955 GN=tlr5a PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00560 LRR_1	7.4e-09	45.7	Leucine Rich Repeat
2	PF18837 LRR_12	12	16.9	Leucine-rich repeat
3	PF12799 LRR_4	2.8e-35	130.9	Leucine Rich repeats (2 copies)
4	PF13306 LRR_5	7.8e-08	43.8	BspA type Leucine rich repeat region (6 copies)
5	PF13855 LRR_8	2e-75	259.8	Leucine rich repeat
6	PF14580 LRR_9	2.2e+02	12.8	Leucine-rich repeat
7	PF01582 TIR	8.6e-13	60.0	TIR domain
8	PF13676 TIR_2	3.7e-07	42.2	TIR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312082

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401399	0.991	Myeloid differentiation primary response protein MyD88
2	9606.ENSP00000227471	0.960	Protein unc-93 homolog B1
3	9606.ENSP00000370034	0.897	Toll-like receptor 7
4	9606.ENSP00000483570	0.885	Tyrosine-protein kinase BTK
5	9606.ENSP00000357123	0.766	Myeloid cell nuclear differentiation antigen
6	9606.ENSP00000369213	0.753	Probable ATP-dependent RNA helicase DDX58
7	9606.ENSP00000263341	0.752	Interleukin-1 beta
8	9606.ENSP00000229332	0.743	C-type lectin domain family 4 member A
9	9606.ENSP00000361926	0.742	Protein canopy homolog 3
10	9606.ENSP00000332049	0.738	T-lymphocyte activation antigen CD86
11	9606.ENSP00000398698	0.738	Tumor necrosis factor
12	9606.ENSP00000263642	0.737	Interferon-induced helicase C domain-containing protein 1
13	9606.ENSP00000376445	0.734	Toll/interleukin-1 receptor domain-containing adapter protein
14	9606.ENSP00000296435	0.733	Cathelicidin antimicrobial peptide
15	9606.ENSP00000276927	0.732	Interferon alpha-1/13
16	9606.ENSP00000284818	0.732	Lymphocyte antigen 96
17	9606.ENSP00000011653	0.724	T-cell surface glycoprotein CD4
18	9606.ENSP00000300589	0.724	Nucleotide-binding oligomerization domain-containing protein 2
19	9606.ENSP00000380697	0.724	Interferon regulatory factor 7
20	9606.ENSP00000363089	0.717	Toll-like receptor 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003727	0.995	single-stranded RNA binding
GO:0003677	0.872	DNA binding
GO:0003725	0.843	double-stranded RNA binding
GO:0042802	0.734	identical protein binding
GO:0038023	0.475	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048518	0.993	positive regulation of biological process
GO:0048583	0.991	regulation of response to stimulus
GO:0002376	0.990	immune system process
GO:0007165	0.990	signal transduction
GO:0019222	0.982	regulation of metabolic process
GO:0048584	0.980	positive regulation of response to stimulus
GO:0080134	0.979	regulation of response to stress
GO:0032101	0.976	regulation of response to external stimulus
GO:0031349	0.971	positive regulation of defense response
GO:0002831	0.970	regulation of response to biotic stimulus
GO:0002684	0.970	positive regulation of immune system process
GO:0009605	0.969	response to external stimulus
GO:0050778	0.961	positive regulation of immune response
GO:0060255	0.954	regulation of macromolecule metabolic process
GO:0032103	0.954	positive regulation of response to external stimulus
GO:0044419	0.948	biological process involved in interspecies interaction between organisms
GO:0043207	0.946	response to external biotic stimulus
GO:0051707	0.944	response to other organism
GO:0006950	0.943	response to stress
GO:0002221	0.936	pattern recognition receptor signaling pathway
GO:0010468	0.921	regulation of gene expression
GO:0006952	0.907	defense response
GO:0001819	0.904	positive regulation of cytokine production
GO:0009615	0.880	response to virus
GO:0032755	0.807	positive regulation of interleukin-6 production
GO:0006955	0.802	immune response
GO:0030522	0.780	intracellular receptor signaling pathway
GO:0002753	0.751	cytosolic pattern recognition receptor signaling pathway
GO:0032479	0.716	regulation of type I interferon production
GO:0048522	0.711	positive regulation of cellular process
GO:0032481	0.680	positive regulation of type I interferon production
GO:0035556	0.660	intracellular signal transduction
GO:0098542	0.627	defense response to other organism
GO:0051171	0.601	regulation of nitrogen compound metabolic process
GO:0032647	0.587	regulation of interferon-alpha production
GO:0032648	0.583	regulation of interferon-beta production
GO:0031323	0.482	regulation of cellular metabolic process
GO:0080090	0.457	regulation of primary metabolic process
GO:0048519	0.417	negative regulation of biological process
GO:0140546	0.369	defense response to symbiont
GO:0042221	0.367	response to chemical
GO:0009966	0.357	regulation of signal transduction
GO:0010033	0.352	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0012505	1.000	endomembrane system
GO:0031410	0.999	cytoplasmic vesicle
GO:0071944	0.993	cell periphery
GO:0005768	0.984	endosome
GO:0005783	0.977	endoplasmic reticulum
GO:0030659	0.976	cytoplasmic vesicle membrane
GO:0005886	0.970	plasma membrane
GO:0098588	0.961	bounding membrane of organelle
GO:0010008	0.890	endosome membrane
GO:0000323	0.868	lytic vacuole
GO:0005764	0.852	lysosome
GO:0005765	0.345	lysosomal membrane
GO:0031984	0.312	organelle subcompartment
GO:0005794	0.301	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]