StarFunc result for job id Q9NRA0

User Input

>input (654 residues)
MNGHLEAEEQQDQRPDQELTGSWGHGPRSTLVRAKAMAPPPPPLAASTPLLHGEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSEWDG
IVTVSGDGLLHEVLNGLLDRPDWEEAVKMPVGILPCGSGNALAGAVNQHGGFEPALGLDL
LLNCSLLLCRGGGHPLDLLSVTLASGSRCFSFLSVAWGFVSDVDIQSERFRALGSARFTL
GTVLGLATLHTYRGRLSYLPATVEPASPTPAHSLPRAKSELTLTPDPAPPMAHSPLHRSV
SDLPLPLPQPALASPGSPEPLPILSLNGGGPELAGDWGGAGDAPLSPDPLLSSPPGSPKA
ALHSPVSEGAPVIPPSSGLPLPTPDARVGASTCGPPDHLLPPLGTPLPPDWVTLEGDFVL
MLAISPSHLGADLVAAPHARFDDGLVHLCWVRSGISRAALLRLFLAMERGSHFSLGCPQL
GYAAARAFRLEPLTPRGVLTVDGEQVEYGPLQAQMHPGIGTLLTGPPGCPGREP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:M0R344	0.821	0.810	0.000	663	0.930	0.917	M0R344.pdb.gz	M0R344_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=1
2	AFDB:Q9JIA7	0.814	0.861	0.000	617	0.786	0.833	Q9JIA7.pdb.gz	SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus OX=10090 GN=Sphk2 PE=1 SV=2
3	AFDB:A0A0R4IC42	0.680	0.516	3.796E-66	869	0.502	0.377	A0A0R4IC42.pdb.gz
4	AFDB:Q53ZR5	0.510	0.863	3.393E-44	384	0.291	0.495	Q53ZR5.pdb.gz	Q53ZR5_HUMAN Sphingosine kinase 1 OS=Homo sapiens OX=9606 GN=SPHK1 PE=2 SV=1
5	AFDB:Q8CI15	0.517	0.880	3.393E-44	382	0.280	0.479	Q8CI15.pdb.gz	SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus OX=10090 GN=Sphk1 PE=1 SV=1
6	AFDB:Q91V26	0.522	0.885	1.407E-43	383	0.271	0.462	Q91V26.pdb.gz	SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus OX=10116 GN=Sphk1 PE=1 SV=1
7	PDB:4l02A	0.509	0.918	3.703E-42	360	0.287	0.522	4l02A.pdb.gz	Structure guided design of a series of sphingosine kinase (SphK) inhibitors.
8	AFDB:Q6B516	0.599	0.520	1.707E-38	760	0.217	0.187	Q6B516.pdb.gz	SPHKB_DICDI Sphingosine kinase B OS=Dictyostelium discoideum OX=44689 GN=sgkB PE=2 SV=1
9	AFDB:Q8L7L1	0.598	0.794	2.125E-38	485	0.223	0.301	Q8L7L1.pdb.gz	SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SPHK1 PE=1 SV=1
10	AFDB:F2Y4A3	0.573	0.763	7.401E-36	481	0.214	0.291	F2Y4A3.pdb.gz	SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=SPHK2 PE=1 SV=1
11	AFDB:A2AQH1	0.521	0.634	9.436E-30	525	0.174	0.217	A2AQH1.pdb.gz	A2AQH1_MOUSE Ceramide kinase-like OS=Mus musculus OX=10090 GN=Cerkl PE=2 SV=1
12	PDB:7cgpB	0.399	0.713	3.461E-18	345	0.098	0.186	7cgpB.pdb.gz
13	PDB:2qv7A	0.366	0.737	1.577E-14	303	0.092	0.198	2qv7A.pdb.gz	Analysis of the Staphylococcus aureus DgkB Structure Reveals a Common Catalytic Mechanism for the Soluble Diacylglycerol Kinases.
14	PDB:2bonA	0.370	0.781	1.640E-11	287	0.089	0.202	2bonA.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
15	PDB:2bonB	0.336	0.758	6.767E-10	265	0.086	0.211	2bonB.pdb.gz	Crystal Structure of Yegs, a Homologue to the Mammalian Diacylglycerol Kinases, Reveals a Novel Regulatory Metal Binding Site.
16	PDB:7n29B	0.239	0.399	1.960E-3	350	0.055	0.103	7n29B.pdb.gz	Structure of human NADK2 reveals atypical assembly and regulation of NAD kinases from animal mitochondria.
17	PDB:6bbpA	0.109	0.131	2.577E-3	520	0.057	0.071	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:3pvuA	0.103	0.109	7.285E-3	609	0.028	0.030	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
19	PDB:7mezB	0.270	0.313	8.127E-3	547	0.075	0.090	7mezB.pdb.gz
20	PDB:6lo8B	0.126	0.407	1.011E-2	176	0.040	0.148	6lo8B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0R344	0.0	1184	663	0.931	0.919	M0R344_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=1
2	Q9JIA7	0.0	894	617	0.784	0.831	SPHK2_MOUSE Sphingosine kinase 2 OS=Mus musculus OX=10090 GN=Sphk2 PE=1 SV=2
3	Q9NRA0	0.0	1284	654	1.000	1.000	SPHK2_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=2
4	M0R0E9	1.81e-180	513	255	0.390	1.000	M0R0E9_HUMAN Sphingosine kinase 2 OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=1
5	M0QXX5	3.76e-85	265	133	0.203	1.000	M0QXX5_HUMAN Sphingosine kinase 2 (Fragment) OS=Homo sapiens OX=9606 GN=SPHK2 PE=1 SV=1
6	Q9VZW0	5.67e-80	268	661	0.297	0.293	Q9VZW0_DROME LD11247p OS=Drosophila melanogaster OX=7227 GN=Sk2 PE=2 SV=3
7	Q9VYY8	8.57e-78	262	641	0.298	0.304	Q9VYY8_DROME RE64552p OS=Drosophila melanogaster OX=7227 GN=Sk1 PE=1 SV=1
8	Q8CI15	3.55e-72	239	382	0.183	0.314	SPHK1_MOUSE Sphingosine kinase 1 OS=Mus musculus OX=10090 GN=Sphk1 PE=1 SV=1
9	Q91V26	1.18e-71	238	383	0.185	0.316	SPHK1_RAT Sphingosine kinase 1 OS=Rattus norvegicus OX=10116 GN=Sphk1 PE=1 SV=1
10	Q53ZR5	1.31e-68	230	384	0.202	0.344	Q53ZR5_HUMAN Sphingosine kinase 1 OS=Homo sapiens OX=9606 GN=SPHK1 PE=2 SV=1
11	Q9NYA1	1.31e-68	230	384	0.202	0.344	SPHK1_HUMAN Sphingosine kinase 1 OS=Homo sapiens OX=9606 GN=SPHK1 PE=1 SV=1
12	Q86KF9	3.08e-52	192	624	0.222	0.232	SPHKA_DICDI Sphingosine kinase A OS=Dictyostelium discoideum OX=44689 GN=sgkA PE=2 SV=2
13	Q8L7L1	1.28e-44	168	485	0.127	0.171	SPHK1_ARATH Sphingosine kinase 1 OS=Arabidopsis thaliana OX=3702 GN=SPHK1 PE=1 SV=1
14	F2Y4A3	8.39e-43	163	481	0.128	0.175	SPHK2_ARATH Sphingosine kinase 2 OS=Arabidopsis thaliana OX=3702 GN=SPHK2 PE=1 SV=1
15	Q9LRB0	3.43e-27	119	763	0.138	0.118	LCBK1_ARATH Sphingoid long-chain bases kinase 1 OS=Arabidopsis thaliana OX=3702 GN=LCBK1 PE=1 SV=1
16	B3H501	5.79e-24	109	778	0.138	0.116	B3H501_ARATH Long-chain base (LCB) kinase 1 OS=Arabidopsis thaliana OX=3702 GN=LCBK1 PE=1 SV=2
17	Q06147	8.14e-24	108	687	0.095	0.090	LCB5_YEAST Sphingoid long chain base kinase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCB5 PE=1 SV=1
18	Q8TCT0	1.34e-23	107	537	0.116	0.142	CERK1_HUMAN Ceramide kinase OS=Homo sapiens OX=9606 GN=CERK PE=1 SV=1
19	Q18425	1.60e-23	106	473	0.124	0.171	SPHK1_CAEEL Sphingosine kinase 1 OS=Caenorhabditis elegans OX=6239 GN=sphk-1 PE=1 SV=1
20	Q12246	3.61e-23	106	624	0.109	0.114	LCB4_YEAST Sphingoid long chain base kinase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LCB4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00781 DAGK_cat	8.8e-26	101.4	Diacylglycerol kinase catalytic domain
2	PF19279 YegS_C	6.2e-06	37.6	YegS C-terminal NAD kinase beta sandwich-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000245222

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362298	0.984	Sphingosine-1-phosphate lyase 1
2	9606.ENSP00000378897	0.981	Neutral ceramidase
3	9606.ENSP00000247225	0.980	Sphingosine-1-phosphate phosphatase 1
4	9606.ENSP00000315137	0.979	Sphingosine-1-phosphate phosphatase 2
5	9606.ENSP00000302564	0.976	Bcl-2-like protein 1
6	9606.ENSP00000476960	0.976	Histone cluster 2 H3 pseudogene 2
7	9606.ENSP00000376453	0.970	Ceramide synthase 6
8	9606.ENSP00000470788	0.969	Interleukin-12 receptor subunit beta-1
9	9606.ENSP00000371152	0.968	Acid ceramidase
10	9606.ENSP00000271688	0.967	Ceramide synthase 2
11	9606.ENSP00000360296	0.965	Phospholipid phosphatase 3
12	9606.ENSP00000316476	0.962	Sphingolipid delta(4)-desaturase DES1
13	9606.ENSP00000325485	0.962	Ceramide synthase 5
14	9606.ENSP00000342609	0.962	Alkaline ceramidase 2
15	9606.ENSP00000434480	0.962	Alkaline ceramidase 3
16	9606.ENSP00000301452	0.961	Alkaline ceramidase 1
17	9606.ENSP00000251363	0.959	Ceramide synthase 4
18	9606.ENSP00000284382	0.956	Ceramide synthase 3
19	9606.ENSP00000307126	0.955	Sphingolipid delta(4)-desaturase/C4-monooxygenase DES2
20	9606.ENSP00000385083	0.949	3-ketodihydrosphingosine reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0017050	0.999	D-erythro-sphingosine kinase activity
GO:0001727	0.835	lipid kinase activity
GO:0016773	0.746	phosphotransferase activity, alcohol group as acceptor
GO:0004930	0.746	G protein-coupled receptor activity
GO:0045125	0.717	bioactive lipid receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006807	0.986	nitrogen compound metabolic process
GO:1901564	0.984	organonitrogen compound metabolic process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0050794	0.970	regulation of cellular process
GO:0044255	0.934	cellular lipid metabolic process
GO:0006665	0.919	sphingolipid metabolic process
GO:0048518	0.892	positive regulation of biological process
GO:0019222	0.874	regulation of metabolic process
GO:1901576	0.847	organic substance biosynthetic process
GO:0044249	0.847	cellular biosynthetic process
GO:0048522	0.800	positive regulation of cellular process
GO:0031323	0.769	regulation of cellular metabolic process
GO:0030148	0.766	sphingolipid biosynthetic process
GO:0080090	0.763	regulation of primary metabolic process
GO:0060255	0.692	regulation of macromolecule metabolic process
GO:0051171	0.660	regulation of nitrogen compound metabolic process
GO:0006793	0.576	phosphorus metabolic process
GO:0050896	0.535	response to stimulus
GO:0044281	0.507	small molecule metabolic process
GO:0009893	0.507	positive regulation of metabolic process
GO:0009889	0.409	regulation of biosynthetic process
GO:0006796	0.405	phosphate-containing compound metabolic process
GO:0048519	0.401	negative regulation of biological process
GO:0065009	0.383	regulation of molecular function
GO:0051716	0.364	cellular response to stimulus
GO:0010468	0.344	regulation of gene expression
GO:0046519	0.335	sphingoid metabolic process
GO:0019751	0.303	polyol metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.995	nuclear lumen
GO:0005654	0.991	nucleoplasm
GO:0012505	0.956	endomembrane system
GO:0016020	0.924	membrane
GO:0005737	0.920	cytoplasm
GO:0005829	0.525	cytosol
GO:0031090	0.468	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:35847	0.999	ATP + sphing-4-enine = ADP + H(+) + sphing-4-enine 1-phosphate
EC:2.7.1.-	0.746	Phosphotransferases with an alcohol group as acceptor.

[back to server]