StarFunc result for job id Q9NRA1

User Input

>input (345 residues)
MSLFGLLLLTSALAGQRQGTQAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHS
PRFPHTYPRNTVLVWRLVAVEENVWIQLTFDERFGLEDPEDDICKYDFVEVEEPSDGTIL
GRWCGSGTVPGKQISKGNQIRIRFVSDEYFPSEPGFCIHYNIVMPQFTEAVSPSVLPPSA
LPLDLLNNAITAFSTLEDLIRYLEPERWQLDLEDLYRPTWQLLGKAFVFGRKSRVVDLNL
LTEEVRLYSCTPRNFSVSIREELKRTDTIFWPGCLLVKRCGGNCACCLHNCNECQCVPSK
VTKKYHEVLQLRPKTGVRGLHKSLTDVALEHHEECDCVCRGSTGG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRA1	1.000	1.000	2.016E-68	345	1.000	1.000	Q9NRA1.pdb.gz	PDGFC_HUMAN Platelet-derived growth factor C OS=Homo sapiens OX=9606 GN=PDGFC PE=1 SV=2
2	AFDB:Q8CI19	0.481	0.481	2.086E-60	345	0.870	0.870	Q8CI19.pdb.gz	PDGFC_MOUSE Platelet-derived growth factor C OS=Mus musculus OX=10090 GN=Pdgfc PE=1 SV=2
3	AFDB:Q9GZP0	0.341	0.318	1.988E-37	370	0.432	0.403	Q9GZP0.pdb.gz	PDGFD_HUMAN Platelet-derived growth factor D OS=Homo sapiens OX=9606 GN=PDGFD PE=1 SV=1
4	AFDB:Q925I7	0.359	0.336	8.195E-35	370	0.438	0.408	Q925I7.pdb.gz	PDGFD_MOUSE Platelet-derived growth factor D OS=Mus musculus OX=10090 GN=Pdgfd PE=2 SV=1
5	AFDB:Q8QFX6	0.318	0.121	4.999E-12	923	0.119	0.044	Q8QFX6.pdb.gz	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
6	AFDB:A3KNA2	0.316	0.115	7.386E-12	959	0.128	0.046	A3KNA2.pdb.gz
7	AFDB:O14786	0.319	0.123	1.091E-11	923	0.136	0.051	O14786.pdb.gz	NRP1_HUMAN Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3
8	AFDB:Q9UGM3	0.309	0.049	5.812E-11	2413	0.096	0.014	Q9UGM3.pdb.gz	DMBT1_HUMAN Deleted in malignant brain tumors 1 protein OS=Homo sapiens OX=9606 GN=DMBT1 PE=1 SV=2
9	AFDB:P79795	0.315	0.121	7.264E-11	914	0.113	0.043	P79795.pdb.gz	NRP1_CHICK Neuropilin-1 OS=Gallus gallus OX=9031 GN=NRP1 PE=2 SV=1
10	AFDB:B0BN34	0.317	0.396	8.121E-11	275	0.110	0.138	B0BN34.pdb.gz	B0BN34_RAT TNF alpha induced protein 6 OS=Rattus norvegicus OX=10116 GN=Tnfaip6 PE=4 SV=1
11	PDB:1wq8A	0.239	0.751	2.744E-6	100	0.070	0.240	1wq8A.pdb.gz
12	PDB:5vqfB	0.171	0.180	2.699E-5	320	0.090	0.097	5vqfB.pdb.gz
13	PDB:3rjrC	0.161	0.162	5.891E-5	343	0.101	0.102	3rjrC.pdb.gz
14	PDB:3am2A	0.218	0.254	9.051E-4	286	0.038	0.045	3am2A.pdb.gz
15	PDB:1m4uA	0.199	0.313	1.671E-3	199	0.081	0.141	1m4uA.pdb.gz
16	PDB:7y1rB	0.164	0.179	2.089E-3	308	0.078	0.088	7y1rB.pdb.gz
17	PDB:1js9C	0.188	0.295	3.086E-3	189	0.070	0.127	1js9C.pdb.gz
18	PDB:4dxzA	0.201	0.490	3.263E-3	111	0.023	0.072	4dxzA.pdb.gz
19	PDB:3gzuJ	0.142	0.127	8.419E-3	397	0.058	0.050	3gzuJ.pdb.gz	Molecular interactions in rotavirus assembly and uncoating seen by high-resolution cryo-EM.
20	PDB:4n20A	0.145	0.089	1.470E-2	639	0.043	0.023	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CI19	0.0	632	345	0.849	0.849	PDGFC_MOUSE Platelet-derived growth factor C OS=Mus musculus OX=10090 GN=Pdgfc PE=1 SV=2
2	Q9NRA1	0.0	714	345	1.000	1.000	PDGFC_HUMAN Platelet-derived growth factor C OS=Homo sapiens OX=9606 GN=PDGFC PE=1 SV=2
3	Q9GZP0	3.72e-93	284	370	0.461	0.430	PDGFD_HUMAN Platelet-derived growth factor D OS=Homo sapiens OX=9606 GN=PDGFD PE=1 SV=1
4	Q9EQT1	4.75e-92	281	370	0.426	0.397	PDGFD_RAT Platelet-derived growth factor D OS=Rattus norvegicus OX=10116 GN=Pdgfd PE=2 SV=1
5	Q925I7	1.79e-85	264	370	0.432	0.403	PDGFD_MOUSE Platelet-derived growth factor D OS=Mus musculus OX=10090 GN=Pdgfd PE=2 SV=1
6	Q6T870	5.80e-13	72.4	959	0.130	0.047	Q6T870_DANRE Neuropilin OS=Danio rerio OX=7955 GN=nrp1b PE=2 SV=1
7	Q8QFX6	2.84e-12	70.1	923	0.125	0.047	NRP1A_DANRE Neuropilin-1a OS=Danio rerio OX=7955 GN=nrp1a PE=2 SV=1
8	P98070	6.95e-12	68.9	707	0.130	0.064	BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis OX=8355 GN=bmp1 PE=1 SV=1
9	Q9Y6L7	6.64e-11	65.9	1015	0.136	0.046	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
10	Q9WVM6	9.50e-11	65.5	1012	0.130	0.044	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
11	F1M798	1.20e-10	65.1	990	0.125	0.043	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
12	P98063	1.33e-10	65.1	991	0.125	0.043	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
13	P13497	1.34e-10	65.1	986	0.125	0.044	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
14	F1QRG7	1.83e-10	64.3	572	0.107	0.065	F1QRG7_DANRE Membrane frizzled-related protein OS=Danio rerio OX=7955 GN=si:cabz01033205.3 PE=4 SV=2
15	O35375	5.05e-10	63.2	931	0.128	0.047	NRP2_MOUSE Neuropilin-2 OS=Mus musculus OX=10090 GN=Nrp2 PE=1 SV=2
16	O57460	7.40e-10	62.8	1022	0.128	0.043	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
17	Q8JI28	7.71e-10	62.8	1007	0.128	0.044	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
18	O60462	7.97e-10	62.8	931	0.125	0.046	NRP2_HUMAN Neuropilin-2 OS=Homo sapiens OX=9606 GN=NRP2 PE=1 SV=3
19	O35276	9.01e-10	62.4	925	0.130	0.049	NRP2_RAT Neuropilin-2 OS=Rattus norvegicus OX=10116 GN=Nrp2 PE=2 SV=1
20	F1REM3	1.05e-09	62.4	976	0.125	0.044	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	8.6e-14	63.2	CUB domain
2	PF00341 PDGF	6.5e-10	50.5	PDGF/VEGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000422464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263923	0.994	Vascular endothelial growth factor receptor 2
2	9606.ENSP00000257290	0.993	Platelet-derived growth factor receptor alpha
3	9606.ENSP00000330382	0.989	Platelet-derived growth factor subunit B
4	9606.ENSP00000346508	0.979	Platelet-derived growth factor subunit A
5	9606.ENSP00000261799	0.976	Platelet-derived growth factor receptor beta
6	9606.ENSP00000220809	0.955	Tissue-type plasminogen activator
7	9606.ENSP00000308938	0.930	Plasminogen
8	9606.ENSP00000282397	0.915	Vascular endothelial growth factor receptor 1
9	9606.ENSP00000265171	0.872	Pro-epidermal growth factor
10	9606.ENSP00000302665	0.872	Insulin-like growth factor I
11	9606.ENSP00000261937	0.869	Vascular endothelial growth factor receptor 3
12	9606.ENSP00000431418	0.851	High affinity nerve growth factor receptor
13	9606.ENSP00000380432	0.845	Insulin
14	9606.ENSP00000295400	0.836	Protransforming growth factor alpha
15	9606.ENSP00000376865	0.821	Platelet-derived growth factor D
16	9606.ENSP00000311127	0.814	Vascular endothelial growth factor B
17	9606.ENSP00000451040	0.805	Placenta growth factor
18	9606.ENSP00000480043	0.787	Vascular endothelial growth factor C
19	9606.ENSP00000277120	0.772	BDNF/NT-3 growth factors receptor
20	9606.ENSP00000275493	0.758	Epidermal growth factor receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0070851	1.000	growth factor receptor binding
GO:0046983	0.996	protein dimerization activity
GO:0042803	0.991	protein homodimerization activity
GO:0005161	0.866	platelet-derived growth factor receptor binding
GO:0098772	0.772	molecular function regulator activity
GO:0140677	0.749	molecular function activator activity
GO:0030545	0.416	signaling receptor regulator activity
GO:0030546	0.410	signaling receptor activator activity
GO:0048018	0.402	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0051716	0.996	cellular response to stimulus
GO:0032501	0.990	multicellular organismal process
GO:0048522	0.990	positive regulation of cellular process
GO:0007165	0.987	signal transduction
GO:0042127	0.985	regulation of cell population proliferation
GO:0008284	0.984	positive regulation of cell population proliferation
GO:0007166	0.983	cell surface receptor signaling pathway
GO:0048856	0.982	anatomical structure development
GO:0007169	0.972	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048145	0.925	regulation of fibroblast proliferation
GO:0007275	0.924	multicellular organism development
GO:0048008	0.897	platelet-derived growth factor receptor signaling pathway
GO:0019222	0.894	regulation of metabolic process
GO:0080090	0.879	regulation of primary metabolic process
GO:0060255	0.879	regulation of macromolecule metabolic process
GO:0051171	0.874	regulation of nitrogen compound metabolic process
GO:0031323	0.872	regulation of cellular metabolic process
GO:0009893	0.870	positive regulation of metabolic process
GO:0048731	0.859	system development
GO:0048146	0.855	positive regulation of fibroblast proliferation
GO:0031325	0.803	positive regulation of cellular metabolic process
GO:0010604	0.797	positive regulation of macromolecule metabolic process
GO:0051173	0.795	positive regulation of nitrogen compound metabolic process
GO:0051246	0.784	regulation of protein metabolic process
GO:0019220	0.776	regulation of phosphate metabolic process
GO:0042325	0.772	regulation of phosphorylation
GO:0048583	0.769	regulation of response to stimulus
GO:0031399	0.731	regulation of protein modification process
GO:0001932	0.714	regulation of protein phosphorylation
GO:0045937	0.698	positive regulation of phosphate metabolic process
GO:0042327	0.674	positive regulation of phosphorylation
GO:0065009	0.673	regulation of molecular function
GO:0050790	0.664	regulation of catalytic activity
GO:0051247	0.658	positive regulation of protein metabolic process
GO:0051239	0.636	regulation of multicellular organismal process
GO:0031401	0.633	positive regulation of protein modification process
GO:0043085	0.605	positive regulation of catalytic activity
GO:0001934	0.588	positive regulation of protein phosphorylation
GO:0042221	0.560	response to chemical
GO:0048519	0.554	negative regulation of biological process
GO:0033674	0.512	positive regulation of kinase activity
GO:0071495	0.457	cellular response to endogenous stimulus
GO:0070887	0.454	cellular response to chemical stimulus
GO:0023051	0.450	regulation of signaling
GO:0010646	0.450	regulation of cell communication
GO:0009966	0.436	regulation of signal transduction
GO:0050730	0.426	regulation of peptidyl-tyrosine phosphorylation
GO:0045860	0.419	positive regulation of protein kinase activity
GO:0051240	0.392	positive regulation of multicellular organismal process
GO:0040012	0.380	regulation of locomotion
GO:0030334	0.366	regulation of cell migration
GO:0048584	0.357	positive regulation of response to stimulus
GO:0048523	0.349	negative regulation of cellular process
GO:0008152	0.329	metabolic process
GO:1902531	0.322	regulation of intracellular signal transduction
GO:0030335	0.307	positive regulation of cell migration
GO:0043410	0.304	positive regulation of MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0012505	0.982	endomembrane system
GO:0071944	0.945	cell periphery
GO:0016020	0.941	membrane
GO:0043231	0.877	intracellular membrane-bounded organelle
GO:0031982	0.871	vesicle
GO:0005615	0.867	extracellular space
GO:0005886	0.866	plasma membrane
GO:0005737	0.863	cytoplasm
GO:0070013	0.847	intracellular organelle lumen
GO:0005788	0.457	endoplasmic reticulum lumen
GO:0000139	0.451	Golgi membrane
GO:0005829	0.380	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]