StarFunc result for job id Q9NRA8

User Input

>input (985 residues)
MDRRSMGETESGDAFLDLKKPPASKCPHRYTKEELLDIKELPHSKQRPSCLSEKYDSDGV
WDPEKWHASLYPASGRSSPVESLKKELDTDRPSLVRRIVDPRERVKEDDLDVVLSPQRRS
FGGGCHVTAAVSSRRSGSPLEKDSDGLRLLGGRRIGSGRIISARTFEKDHRLSDKDLRDL
RDRDRERDFKDKRFRREFGDSKRVFGERRRNDSYTEEEPEWFSAGPTSQSETIELTGFDD
KILEEDHKGRKRTRRRTASVKEGIVECNGGVAEEDEVEVILAQEPAADQEVPRDAVLPEQ
SPGDFDFNEFFNLDKVPCLASMIEDVLGEGSVSASRFSRWFSNPSRSGSRSSSLGSTPHE
ELERLAGLEQAILSPGQNSGNYFAPIPLEDHAENKVDILEMLQKAKVDLKPLLSSLSANK
EKLKESSHSGVVLSVEEVEAGLKGLKVDQQVKNSTPFMAEHLEETLSAVTNNRQLKKDGD
MTAFNKLVSTMKASGTLPSQPKVSRNLESHLMSPAEIPGQPVPKNILQELLGQPVQRPAS
SNLLSGLMGSLEPTTSLLGQRAPSPPLSQVFQTRAASADYLRPRIPSPIGFTPGPQQLLG
DPFQGMRKPMSPITAQMSQLELQQAALEGLALPHDLAVQAANFYQPGFGKPQVDRTRDGF
RNRQQRVTKSPAPVHRGNSSSPAPAASITSMLSPSFTPTSVIRKMYESKEKSKEEPASGK
AALGDSKEDTQKASEENLLSSSSVPSADRDSSPTTNSKLSALQRSSCSTPLSQANRYTKE
QDYRPKATGRKTPTLASPVPTTPFLRPVHQVPLVPHVPMVRPAHQLHPGLVQRMLAQGVH
PQHLPSLLQTGVLPPGMDLSHLQGISGPILGQPFYPLPAASHPLLNPRPGTPLHLAMVQQ
QLQRSVLHPPGSGSHAAAVSVQTTPQNVPSRSGLPHMHSQLEHRPSQRSSSPVGLAKWFG
SDVLQQPLPSMPAKVISVDELEYRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1K0	0.109	0.109	0.000	985	1.000	1.000	A0A024R1K0.pdb.gz
2	AFDB:B1AKL4	0.097	0.098	0.000	961	0.974	0.998	B1AKL4.pdb.gz	B1AKL4_HUMAN Eukaryotic translation initiation factor 4E nuclear import factor 1 OS=Homo sapiens OX=9606 GN=EIF4ENIF1 PE=1 SV=1
3	AFDB:E7FDR0	0.122	0.126	9.209E-69	944	0.534	0.557	E7FDR0.pdb.gz	E7FDR0_DANRE Eukaryotic translation initiation factor 4E nuclear import factor 1 OS=Danio rerio OX=7955 GN=wu:fd15a05 PE=4 SV=1
4	AFDB:Q24595	0.054	0.045	2.154E-5	1293	0.144	0.110	Q24595.pdb.gz	XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster OX=7227 GN=Xpc PE=1 SV=2
5	AFDB:Q9S7I0	0.048	0.039	4.486E-5	1307	0.142	0.107	Q9S7I0.pdb.gz	TADA_ARATH tRNA(adenine(34)) deaminase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=TADA PE=1 SV=1
6	AFDB:Q86VM9	0.051	0.052	1.123E-4	953	0.148	0.153	Q86VM9.pdb.gz	ZCH18_HUMAN Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2
7	AFDB:E7ERS3	0.040	0.040	3.243E-3	977	0.140	0.141	E7ERS3.pdb.gz	E7ERS3_HUMAN Zinc finger CCCH-type containing 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=1
8	AFDB:Q3UVR3	0.038	0.034	3.448E-3	1243	0.174	0.138	Q3UVR3.pdb.gz	TTBK2_MOUSE Tau-tubulin kinase 2 OS=Mus musculus OX=10090 GN=Ttbk2 PE=1 SV=1
9	AFDB:Q9UMS6	0.043	0.040	5.624E-3	1093	0.145	0.131	Q9UMS6.pdb.gz	SYNP2_HUMAN Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2
10	AFDB:G4SNP7	0.043	0.034	5.978E-3	1427	0.133	0.092	G4SNP7.pdb.gz	G4SNP7_CAEEL VWFA domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dpy-1 PE=1 SV=3
11	PDB:6f40W	0.035	0.082	5.700	218	0.029	0.133	6f40W.pdb.gz	Molecular mechanism of promoter opening by RNA polymerase III.
12	PDB:7ae1M	0.030	0.060	5.700	400	0.037	0.090	7ae1M.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
13	PDB:7dcoL	0.029	0.056	6.848	435	0.036	0.080	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
14	PDB:6wg3C	0.032	0.089	8.746	248	0.017	0.069	6wg3C.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
15	PDB:7ungi	0.031	0.086	9.297	250	0.037	0.144	7ungi.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:7dvq2	0.037	0.099	9.884	216	0.020	0.093	7dvq2.pdb.gz	Structure of the activated human minor spliceosome.
17	PDB:7ls2V2	0.037	0.163	9.884	117	0.025	0.214	7ls2V2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AKL4	0.0	1932	961	0.976	1.000	B1AKL4_HUMAN Eukaryotic translation initiation factor 4E nuclear import factor 1 OS=Homo sapiens OX=9606 GN=EIF4ENIF1 PE=1 SV=1
2	E7FDR0	0.0	820	944	0.549	0.573	E7FDR0_DANRE Eukaryotic translation initiation factor 4E nuclear import factor 1 OS=Danio rerio OX=7955 GN=wu:fd15a05 PE=4 SV=1
3	Q9EST3	0.0	1706	983	0.898	0.900	4ET_MOUSE Eukaryotic translation initiation factor 4E transporter OS=Mus musculus OX=10090 GN=Eif4enif1 PE=1 SV=2
4	Q9NRA8	0.0	1998	985	1.000	1.000	4ET_HUMAN Eukaryotic translation initiation factor 4E transporter OS=Homo sapiens OX=9606 GN=EIF4ENIF1 PE=1 SV=2
5	Q6DE09	1.11e-165	506	771	0.293	0.375	Q6DE09_XENLA Eif4enif1-prov protein OS=Xenopus laevis OX=8355 GN=eif4enif1.S PE=2 SV=1
6	B0QYZ7	7.37e-157	463	239	0.243	1.000	B0QYZ7_HUMAN Eukaryotic translation initiation factor 4E nuclear import factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=EIF4ENIF1 PE=1 SV=1
7	Q5BL27	1.73e-119	384	747	0.211	0.278	Q5BL27_DANRE Eukaryotic translation initiation factor 4E nuclear import factor 1 OS=Danio rerio OX=7955 GN=fd15a05 PE=2 SV=1
8	Q8IH18	5.92e-08	59.3	1010	0.058	0.056	4ET_DROME Eukaryotic translation initiation factor 4E transporter OS=Drosophila melanogaster OX=7227 GN=4E-T PE=1 SV=1
9	Q20898	1.21e-06	55.1	761	0.060	0.078	IFET1_CAEEL Translational repressor ifet-1 OS=Caenorhabditis elegans OX=6239 GN=ifet-1 PE=1 SV=2
10	Q9VMA3	1.15e-05	52.0	1117	0.035	0.030	CUP_DROME Protein cup OS=Drosophila melanogaster OX=7227 GN=cup PE=1 SV=3
11	Q803Q7	0.67	35.8	364	0.044	0.118	Q803Q7_DANRE Fructose-bisphosphate aldolase OS=Danio rerio OX=7955 GN=wu:fa28b10 PE=1 SV=1
12	O88845	7.9	32.7	662	0.024	0.036	AKA10_MOUSE A-kinase anchor protein 10, mitochondrial OS=Mus musculus OX=10090 GN=Akap10 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10477 EIF4E-T	4.3e-172	586.0	Nucleocytoplasmic shuttling protein for mRNA cap-binding EIF4E
2	PF00274 Glycolytic	48	14.1	Fructose-bisphosphate aldolase class-I

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380659

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000425561	0.999	Eukaryotic translation initiation factor 4E
2	9606.ENSP00000478754	0.998	Probable ATP-dependent RNA helicase DDX6
3	9606.ENSP00000446271	0.986	Protein LSM14 homolog A
4	9606.ENSP00000323714	0.978	Eukaryotic translation initiation factor 4E type 1B
5	9606.ENSP00000258416	0.974	Eukaryotic translation initiation factor 4E type 2
6	9606.ENSP00000320949	0.961	CCR4-NOT transcription complex subunit 1
7	9606.ENSP00000370981	0.858	Leucine zipper putative tumor suppressor 1
8	9606.ENSP00000279068	0.824	Protein LSM14 homolog B
9	9606.ENSP00000300146	0.824	Protein PAT1 homolog 1
10	9606.ENSP00000355094	0.822	Protein quaking
11	9606.ENSP00000248114	0.817	FAD-linked sulfhydryl oxidase ALR
12	9606.ENSP00000301732	0.817	ATP-binding cassette sub-family A member 3
13	9606.ENSP00000312250	0.817	ADP-dependent glucokinase
14	9606.ENSP00000360108	0.817	Putative tyrosine-protein phosphatase auxilin
15	9606.ENSP00000367823	0.817	Protein FAM214B
16	9606.ENSP00000371211	0.817	Transmembrane protease serine 6
17	9606.ENSP00000380019	0.817	Zinc finger protein 384
18	9606.ENSP00000380793	0.817	Dol-P-Man:Man(5)GlcNAc(2)-PP-Dol alpha-1,3-mannosyltransferase
19	9606.ENSP00000482968	0.817	Alstrom syndrome protein 1
20	9606.ENSP00000477715	0.787	Cytoplasmic polyadenylation element-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.439	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0009987	0.993	cellular process
GO:0048523	0.990	negative regulation of cellular process
GO:0010605	0.990	negative regulation of macromolecule metabolic process
GO:0051172	0.986	negative regulation of nitrogen compound metabolic process
GO:0006417	0.986	regulation of translation
GO:0017148	0.978	negative regulation of translation
GO:0008152	0.780	metabolic process
GO:0071704	0.707	organic substance metabolic process
GO:0009893	0.705	positive regulation of metabolic process
GO:0051252	0.689	regulation of RNA metabolic process
GO:0044238	0.648	primary metabolic process
GO:0048522	0.648	positive regulation of cellular process
GO:0006807	0.642	nitrogen compound metabolic process
GO:0010604	0.623	positive regulation of macromolecule metabolic process
GO:0031329	0.606	regulation of cellular catabolic process
GO:0044237	0.596	cellular metabolic process
GO:0031325	0.594	positive regulation of cellular metabolic process
GO:0043487	0.558	regulation of RNA stability
GO:0043170	0.556	macromolecule metabolic process
GO:0061013	0.545	regulation of mRNA catabolic process
GO:0071840	0.509	cellular component organization or biogenesis
GO:0051173	0.507	positive regulation of nitrogen compound metabolic process
GO:0034641	0.479	cellular nitrogen compound metabolic process
GO:0016043	0.451	cellular component organization
GO:0043488	0.449	regulation of mRNA stability
GO:0031331	0.399	positive regulation of cellular catabolic process
GO:0045934	0.394	negative regulation of nucleobase-containing compound metabolic process
GO:0031047	0.393	RNA-mediated gene silencing
GO:0140694	0.377	non-membrane-bounded organelle assembly
GO:0061014	0.368	positive regulation of mRNA catabolic process
GO:0009895	0.366	negative regulation of catabolic process
GO:0016441	0.365	post-transcriptional gene silencing
GO:0051253	0.359	negative regulation of RNA metabolic process
GO:0031330	0.357	negative regulation of cellular catabolic process
GO:0010628	0.352	positive regulation of gene expression
GO:0035195	0.350	miRNA-mediated gene silencing
GO:0070727	0.344	cellular macromolecule localization
GO:0008104	0.332	protein localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0005634	0.997	nucleus
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0005829	0.955	cytosol
GO:0099080	0.947	supramolecular complex
GO:0035770	0.936	ribonucleoprotein granule
GO:0036464	0.915	cytoplasmic ribonucleoprotein granule
GO:0016020	0.827	membrane
GO:0000932	0.513	P-body
GO:0070013	0.315	intracellular organelle lumen
GO:0031981	0.310	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]