StarFunc result for job id Q9NRC6

User Input

>input (1400 residues)
MAGQPHSPRELLGAAGHRSRRPSTELRVPPSPSLTMDSQYETGHIRKLQARHMQMQEKTF
TKWINNVFQCGQAGIKIRNLYTELADGIHLLRLLELISGEALPPPSRGRLRVHFLENSSR
ALAFLRAKVPVPLIGPENIVDGDQTLILGLIWVIILRFQISHISLDKEEFGASAALLSTK
EALLVWCQRKTASYTNVNITDFSRSWSDGLGFNALIHAHRPDLLDYGSLRPDRPLHNLAF
AFLVAEQELGIAQLLDPEDVAAAQPDERSIMTYVSLYYHYCSRLHQGQTVQRRLTKILLQ
LQETELLQTQYEQLVADLLRWIAEKQMQLEARDFPDSLPAMRQLLAAFTIFRTQEKPPRL
QQRGAAEALLFRLQTALQAQNRRPFLPHEGLGLAELSQCWAGLEWAEAARSQALQQRLLQ
LQRLETLARRFQHKAALRESFLKDAEQVLDQARAPPASLATVEAAVQRLGMLEAGILPQE
GRFQALAEIADILRQEQYHSWADVARRQEEVTVRWQRLLQHLQGQRKQVADMQAVLSLLQ
EVEAASHQLEELQEPARSTACGQQLAEVVELLQRHDLLEAQVSAHGAHVSHLAQQTAELD
SSLGTSVEVLQAKARTLAQLQQSLVALVRARRALLEQTLQRAEFLRNCEEEEAWLKECGQ
RVGNAALGRDLSQIAGALQKHKALEAEVHRHQAVCVDLVRRGRDLSARRPPTQPDPGERA
EAVQGGWQLLQTRVVGRGARLQTALLVLQYFADAAEAASWLRERRSSLERASCGQDQAAA
ETLLRRHVRLERVLRAFAAELRRLEEQGRAASARASLFTVNSALSPPGESLRNPGPWSEA
SCHPGPGDAWKMALPAEPDPDFDPNTILQTQDHLSQDYESLRALAQLRRARLEEAMALFG
FCSSCGELQLWLEKQTVLLQRVQPQADTLEVMQLKYENFLTALAVGKGLWAEVSSSAEQL
RQRYPGNSTQIQRQQEELSQRWGQLEALKREKAVQLAHSVEVCSFLQECGPTQVQLRDVL
LQLEALQPGSSEDTCHALQLAQKKTLVLERRVHFLQSVVVKVEEPGYAESQPLQGQVETL
QGLLKQVQEQVAQRARRQAETQARQSFLQESQQLLLWAESVQAQLRSKEVSVDVASAQRL
LREHQDLLEEIHLWQERLQQLDAQSQPMAALDCPDSQEVPNTLRVLGQQGQELKVLWEQR
QQWLQEGLELQKFGREVDGFTATCANHQAWLHLDNLGEDVREALSLLQQHREFGRLLSTL
GPRAEALRAHGEKLVQSQHPAAHTVREQLQSIQAQWTRLQGRSEQRRRQLLASLQLQEWK
QDVAELMQWMEEKGLMAAHEPSGARRNILQTLKRHEAAESELLATRRHVEALQQVGRELL
SRRPCGQEDIQTRLQGLRSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q00963	0.261	0.178	5.626E-63	2291	0.283	0.173	Q00963.pdb.gz	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
2	AFDB:Q01082	0.204	0.136	1.008E-61	2364	0.279	0.165	Q01082.pdb.gz	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
3	AFDB:O15020	0.189	0.123	1.408E-61	2390	0.303	0.177	O15020.pdb.gz	SPTN2_HUMAN Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=3
4	AFDB:E0AHA7	0.233	0.150	4.176E-61	2326	0.289	0.174	E0AHA7.pdb.gz	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
5	AFDB:P11277	0.204	0.145	5.596E-61	2137	0.277	0.182	P11277.pdb.gz	SPTB1_HUMAN Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB PE=1 SV=5
6	AFDB:F1QQE5	0.183	0.119	1.048E-60	2357	0.281	0.167	F1QQE5.pdb.gz	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
7	AFDB:Q9H254	0.256	0.153	7.715E-56	2564	0.292	0.160	Q9H254.pdb.gz	SPTN4_HUMAN Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens OX=9606 GN=SPTBN4 PE=1 SV=2
8	AFDB:B2R8Y4	0.237	0.336	5.019E-36	901	0.173	0.269	B2R8Y4.pdb.gz	B2R8Y4_HUMAN cDNA, FLJ94117, highly similar to Homo sapiens actinin, alpha 3 (ACTN3), mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
9	AFDB:A4QPE4	0.193	0.268	7.625E-36	934	0.163	0.244	A4QPE4.pdb.gz	A4QPE4_HUMAN SPTBN2 protein OS=Homo sapiens OX=9606 GN=SPTBN2 PE=1 SV=1
10	AFDB:Q9XVU8	0.206	0.294	8.290E-36	894	0.171	0.267	Q9XVU8.pdb.gz	Q9XVU8_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
11	PDB:4d1eA	0.305	0.481	4.464E-28	859	0.159	0.260	4d1eA.pdb.gz
12	PDB:1sjjA	0.142	0.218	1.102E-21	863	0.157	0.255	1sjjA.pdb.gz
13	PDB:7sx8D	0.130	0.356	6.649E-5	448	0.041	0.127	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
14	PDB:7sukSP	0.052	0.042	1.468E-3	2234	0.114	0.072	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:7z8fe	0.090	0.045	1.530E-3	4579	0.128	0.039	7z8fe.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
16	PDB:7qdrB	0.049	0.055	5.834E-3	1212	0.116	0.134	7qdrB.pdb.gz
17	PDB:7mqaLM	0.050	0.040	6.896E-3	2041	0.099	0.068	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7t3uA	0.061	0.046	1.346E-2	2020	0.124	0.086	7t3uA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
19	PDB:7nj1A	0.044	0.043	1.592E-2	1448	0.106	0.102	7nj1A.pdb.gz
20	PDB:7jq9A	0.061	0.039	1.881E-2	2427	0.089	0.052	7jq9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A571BF02	0.0	1693	3624	0.666	0.257	A0A571BF02_MOUSE Spectrin beta, non-erythrocytic 5 OS=Mus musculus OX=10090 GN=Sptbn5 PE=1 SV=1
2	F7HAE6	0.0	2554	3697	0.938	0.355	F7HAE6_MACMU Spectrin beta, non-erythrocytic 5 OS=Macaca mulatta OX=9544 GN=SPTBN5 PE=3 SV=3
3	G5EBH3	0.0	650	3953	0.317	0.112	G5EBH3_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
4	G5EC35	0.0	650	4063	0.317	0.109	G5EC35_CAEEL Beta chain spectrin homolog Sma1 OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
5	G5EFW3	0.0	651	4166	0.317	0.107	G5EFW3_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
6	G5EG97	0.0	611	3980	0.299	0.105	G5EG97_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=sma-1 PE=1 SV=1
7	Q00963	0.0	598	2291	0.292	0.179	SPTCB_DROME Spectrin beta chain OS=Drosophila melanogaster OX=7227 GN=beta-Spec PE=1 SV=2
8	Q9NRC6	0.0	2790	3674	1.000	0.381	SPTN5_HUMAN Spectrin beta chain, non-erythrocytic 5 OS=Homo sapiens OX=9606 GN=SPTBN5 PE=1 SV=2
9	G5EG85	1.04e-178	587	2257	0.296	0.184	G5EG85_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
10	Q9U9J8	1.81e-178	587	2302	0.296	0.180	Q9U9J8_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
11	E0AHA7	5.22e-178	586	2326	0.294	0.177	E0AHA7_CAEEL Spectrin beta chain OS=Caenorhabditis elegans OX=6239 GN=unc-70 PE=1 SV=1
12	Q01082	1.57e-174	577	2364	0.285	0.169	SPTB2_HUMAN Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2
13	Q9DGM6	4.16e-174	576	2357	0.291	0.173	Q9DGM6_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
14	A0A0G2JZY6	4.03e-173	570	2152	0.286	0.186	A0A0G2JZY6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=2
15	Q6XD99	4.69e-173	573	2358	0.286	0.170	Q6XD99_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=2 SV=1
16	F1QQE5	4.70e-173	573	2357	0.291	0.173	F1QQE5_DANRE Spectrin beta chain OS=Danio rerio OX=7955 GN=wu:fa09g12 PE=1 SV=1
17	Q62261	2.46e-172	571	2363	0.285	0.169	SPTB2_MOUSE Spectrin beta chain, non-erythrocytic 1 OS=Mus musculus OX=10090 GN=Sptbn1 PE=1 SV=2
18	G3V6S0	8.16e-171	566	2361	0.286	0.169	G3V6S0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptbn1 PE=1 SV=4
19	A0A140UHX6	3.59e-168	556	2117	0.298	0.197	A0A140UHX6_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=2
20	Q6XDA0	4.34e-168	556	2137	0.298	0.195	Q6XDA0_RAT Spectrin beta chain OS=Rattus norvegicus OX=10116 GN=Sptb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	0.82	20.8	CAMSAP CH domain
2	PF00307 CH	1e-39	146.5	Calponin homology (CH) domain
3	PF18261 Rpn9_C	3.8e+02	12.1	Rpn9 C-terminal helix
4	PF00435 Spectrin	1e-89	307.3	Spectrin repeat
5	PF03367 zf-ZPR1	52	15.1	ZPR1 zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317790

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361824	0.975	Spectrin alpha chain, non-erythrocytic 1
2	9606.ENSP00000263373	0.923	Spectrin beta chain, non-erythrocytic 4
3	9606.ENSP00000432568	0.918	Spectrin beta chain, non-erythrocytic 2
4	9606.ENSP00000362680	0.917	Proto-oncogene tyrosine-protein kinase Src
5	9606.ENSP00000256078	0.911	GTPase KRas
6	9606.ENSP00000407586	0.907	GTPase HRas
7	9606.ENSP00000358548	0.905	GTPase NRas
8	9606.ENSP00000357129	0.838	Spectrin alpha chain, erythrocytic 1
9	9606.ENSP00000349588	0.801	Ankyrin-2
10	9606.ENSP00000280772	0.800	Ankyrin-3
11	9606.ENSP00000349259	0.790	Spectrin beta chain, non-erythrocytic 1
12	9606.ENSP00000384950	0.776	Sulfotransferase 6B1
13	9606.ENSP00000338481	0.768	Band 4.1-like protein 2
14	9606.ENSP00000451752	0.765	Spectrin beta chain, erythrocytic
15	9606.ENSP00000330485	0.746	Palmitoyltransferase ZDHHC23
16	9606.ENSP00000265709	0.723	Ankyrin-1
17	9606.ENSP00000328426	0.705	Protein FAM208B
18	9606.ENSP00000344786	0.663	Neurofascin
19	9606.ENSP00000396320	0.654	Sodium channel protein type 4 subunit alpha
20	9606.ENSP00000377275	0.652	Golgin subfamily B member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	1.000	cytoskeletal protein binding
GO:0044877	0.999	protein-containing complex binding
GO:0030507	0.994	spectrin binding
GO:0003779	0.992	actin binding
GO:0017022	0.720	myosin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.973	cellular process
GO:0071840	0.911	cellular component organization or biogenesis
GO:0007030	0.864	Golgi organization
GO:0007041	0.768	lysosomal transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005737	0.997	cytoplasm
GO:0043228	0.980	non-membrane-bounded organelle
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0043227	0.957	membrane-bounded organelle
GO:0016020	0.947	membrane
GO:0071944	0.942	cell periphery
GO:0005856	0.894	cytoskeleton
GO:0005829	0.882	cytosol
GO:0120025	0.833	plasma membrane bounded cell projection
GO:0005929	0.823	cilium
GO:0099568	0.714	cytoplasmic region
GO:0005886	0.704	plasma membrane
GO:0043231	0.589	intracellular membrane-bounded organelle
GO:0043005	0.520	neuron projection
GO:0012505	0.431	endomembrane system
GO:0031090	0.424	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]