StarFunc result for job id Q9NRC8

User Input

>input (400 residues)
MAAGGLSRSERKAAERVRRLREEQQRERLRQVSRILRKAAAERSAEEGRLLAESADLVTE
LQGRSRRREGLKRRQEEVCDDPEELRGKVRELASAVRNAKYLVVYTGAGISTAASIPDYR
GPNGVWTLLQKGRSVSAADLSEAEPTLTHMSITRLHEQKLVQHVVSQNCDGLHLRSGLPR
TAISELHGNMYIEVCTSCVPNREYVRVFDVTERTALHRHQTGRTCHKCGTQLRDTIVHFG
ERGTLGQPLNWEAATEAASRADTILCLGSSLKVLKKYPRLWCMTKPPSRRPKLYIVNLQW
TPKDDWAALKLHGKCDDVMRLLMAELGLEIPAYSRWQDPIFSLATPLRAGEEGSHSRKSL
CRSREEAPPGDRGAPLSSAPILGGWFGRGCTKRTKRKKVT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BKJ9	0.958	0.953	1.208E-77	402	0.948	0.943	Q8BKJ9.pdb.gz	SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus OX=10090 GN=Sirt7 PE=1 SV=2
2	AFDB:A0A2R8QUG9	0.916	0.905	6.559E-59	405	0.645	0.637	A0A2R8QUG9.pdb.gz	A0A2R8QUG9_DANRE NAD-dependent protein deacetylase sirtuin-7 OS=Danio rerio OX=7955 GN=sirt7 PE=4 SV=1
3	AFDB:A0A250YGJ5	0.587	0.659	4.606E-28	355	0.320	0.361	A0A250YGJ5.pdb.gz	SIR6_CASCN NAD-dependent protein deacylase sirtuin-6 OS=Castor canadensis OX=51338 GN=SIRT6 PE=1 SV=1
4	AFDB:P59941	0.591	0.702	2.376E-27	334	0.295	0.353	P59941.pdb.gz	SIR6_MOUSE NAD-dependent protein deacylase sirtuin-6 OS=Mus musculus OX=10090 GN=Sirt6 PE=1 SV=1
5	AFDB:Q9FE17	0.585	0.497	5.910E-27	473	0.263	0.222	Q9FE17.pdb.gz	SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana OX=3702 GN=SRT1 PE=1 SV=1
6	PDB:7cl1A	0.571	0.765	3.463E-26	296	0.282	0.382	7cl1A.pdb.gz	Reply to: Binding site for MDL-801 on SIRT6.
7	AFDB:Q9VH08	0.574	0.718	1.233E-25	317	0.255	0.322	Q9VH08.pdb.gz	SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster OX=7227 GN=Sirt6 PE=1 SV=1
8	AFDB:Q95Q89	0.552	0.746	3.342E-21	292	0.198	0.271	Q95Q89.pdb.gz	SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans OX=6239 GN=sir-2.4 PE=3 SV=2
9	AFDB:Q8IKW2	0.536	0.171	4.903E-18	1304	0.185	0.057	Q8IKW2.pdb.gz	SIR2B_PLAF7 NAD-dependent protein deacetylase Sir2B OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=Sir2B PE=1 SV=1
10	AFDB:Q1JQC6	0.463	0.578	2.380E-17	315	0.182	0.232	Q1JQC6.pdb.gz	SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus OX=9913 GN=SIRT4 PE=2 SV=1
11	AFDB:Q8R216	0.471	0.560	2.529E-17	333	0.185	0.222	Q8R216.pdb.gz	SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus OX=10090 GN=Sirt4 PE=1 SV=3
12	PDB:3u31A	0.450	0.660	3.491E-15	263	0.163	0.247	3u31A.pdb.gz	Plasmodium falciparum Sir2A Preferentially Hydrolyzes Medium and Long Chain Fatty Acyl Lysine
13	PDB:1q14A	0.406	0.542	4.789E-13	289	0.145	0.201	1q14A.pdb.gz	Structure and autoregulation of the Yeast Hst2 homolog of Sir2
14	PDB:5fyqA	0.412	0.564	5.783E-12	282	0.145	0.206	5fyqA.pdb.gz	Insights Into Lysine-Deacetylation of Natively Folded Substrate Proteins by Sirtuins.
15	PDB:6fkyB	0.409	0.590	1.635E-10	266	0.150	0.226	6fkyB.pdb.gz	Potent and Selective Inhibitors of Human Sirtuin 5.
16	PDB:6lpiB	0.276	0.209	8.753E-4	539	0.077	0.058	6lpiB.pdb.gz	Molecular architecture of the acetohydroxyacid synthase holoenzyme.
17	PDB:2ihvA	0.277	0.204	1.423E-3	563	0.065	0.046	2ihvA.pdb.gz	Structural and mechanistic studies on N(2)-(2-carboxyethyl)arginine synthase.
18	PDB:1t9bA	0.244	0.173	1.928E-3	583	0.083	0.057	1t9bA.pdb.gz	Elucidating the specificity of binding of sulfonylurea herbicides to acetohydroxyacid synthase.
19	PDB:2ji6A	0.258	0.190	2.459E-3	559	0.077	0.055	2ji6A.pdb.gz	Crystallographic Snapshots of Oxalyl-Coa Decarboxylase Give Insights Into Catalysis by Nonoxidative Thdp-Dependent Decarboxylases
20	PDB:6u9dB	0.246	0.169	2.459E-3	607	0.083	0.054	6u9dB.pdb.gz	Structures of fungal and plant acetohydroxyacid synthases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8QUG9	0.0	525	405	0.647	0.640	A0A2R8QUG9_DANRE NAD-dependent protein deacetylase sirtuin-7 OS=Danio rerio OX=7955 GN=sirt7 PE=4 SV=1
2	Q8BKJ9	0.0	768	402	0.943	0.938	SIR7_MOUSE NAD-dependent protein deacetylase sirtuin-7 OS=Mus musculus OX=10090 GN=Sirt7 PE=1 SV=2
3	Q9NRC8	0.0	815	400	1.000	1.000	SIR7_HUMAN NAD-dependent protein deacetylase sirtuin-7 OS=Homo sapiens OX=9606 GN=SIRT7 PE=1 SV=1
4	Q9FE17	4.10e-56	193	473	0.273	0.230	SIR1_ARATH NAD-dependent protein deacetylase SRT1 OS=Arabidopsis thaliana OX=3702 GN=SRT1 PE=1 SV=1
5	A0A250YGJ5	4.28e-55	187	355	0.300	0.338	SIR6_CASCN NAD-dependent protein deacylase sirtuin-6 OS=Castor canadensis OX=51338 GN=SIRT6 PE=1 SV=1
6	A0A2K5TU92	1.61e-52	181	355	0.292	0.330	SIR6_MACFA NAD-dependent protein deacylase sirtuin-6 OS=Macaca fascicularis OX=9541 GN=SIRT6 PE=1 SV=2
7	Q8N6T7	3.46e-52	179	355	0.292	0.330	SIR6_HUMAN NAD-dependent protein deacylase sirtuin-6 OS=Homo sapiens OX=9606 GN=SIRT6 PE=1 SV=2
8	P59941	7.31e-50	173	334	0.285	0.341	SIR6_MOUSE NAD-dependent protein deacylase sirtuin-6 OS=Mus musculus OX=10090 GN=Sirt6 PE=1 SV=1
9	A0A8I6APP5	3.39e-48	168	314	0.280	0.357	A0A8I6APP5_RAT Sirtuin 6 OS=Rattus norvegicus OX=10116 GN=Sirt6 PE=4 SV=1
10	Q9VH08	6.13e-42	151	317	0.263	0.331	SIR6_DROME NAD-dependent protein deacetylase Sirt6 OS=Drosophila melanogaster OX=7227 GN=Sirt6 PE=1 SV=1
11	Q95Q89	4.69e-30	119	292	0.193	0.264	SIR24_CAEEL NAD-dependent protein deacetylase sir-2.4 OS=Caenorhabditis elegans OX=6239 GN=sir-2.4 PE=3 SV=2
12	P66815	3.46e-19	88.2	243	0.185	0.305	NPD_STAAM NAD-dependent protein deacetylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) OX=158878 GN=cobB PE=1 SV=1
13	Q1JQC6	2.39e-18	87.0	315	0.200	0.254	SIR4_BOVIN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Bos taurus OX=9913 GN=SIRT4 PE=2 SV=1
14	M0QZ09	6.32e-18	85.5	275	0.175	0.255	M0QZ09_HUMAN Sirtuin 6 (Fragment) OS=Homo sapiens OX=9606 GN=SIRT6 PE=1 SV=8
15	Q9Y6E7	7.40e-18	85.9	314	0.205	0.261	SIR4_HUMAN NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT4 PE=1 SV=1
16	Q9USN7	3.95e-17	84.0	332	0.160	0.193	HST2_SCHPO NAD-dependent protein deacetylase hst2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=hst2 PE=3 SV=1
17	Q8R216	2.98e-16	81.3	333	0.210	0.252	SIR4_MOUSE NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Mus musculus OX=10090 GN=Sirt4 PE=1 SV=3
18	G3V641	1.13e-15	79.3	311	0.188	0.241	G3V641_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
19	A0A0G2K6D8	1.26e-15	79.3	319	0.188	0.235	A0A0G2K6D8_RAT NAD-dependent protein lipoamidase sirtuin-4, mitochondrial OS=Rattus norvegicus OX=10116 GN=Sirt4 PE=3 SV=1
20	Q20480	2.22e-15	78.2	287	0.185	0.258	SIR41_CAEEL NAD-dependent protein deacylase sir-2.2 OS=Caenorhabditis elegans OX=6239 GN=sir-2.2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04577 Glyco_transf_61	20	16.7	Glycosyltransferase 61
2	PF02146 SIR2	4.5e-23	93.6	Sir2 family
3	PF00205 TPP_enzyme_M	2.5e+02	12.8	Thiamine pyrophosphate enzyme, central domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000015834

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000007630	0.956	Belongs to the NAPRTase family.
2	60711.ENSCSAP00000005682	0.932	Glutamine-dependent NAD(+) synthetase
3	60711.ENSCSAP00000015288	0.922	Nicotinamide N-methyltransferase
4	60711.ENSCSAP00000012718	0.918	The purine nucleoside phosphorylases catalyze the phosphorolytic breakdown of the N-glycosidic bond in the beta- (deoxy)ribonucleoside molecules, with the formation of the corresponding free purine bases and pentose-1-phosphate.
5	60711.ENSCSAP00000012804	0.917	Nicotinamide nucleotide transhydrogenase
6	60711.ENSCSAP00000011231	0.910	Nudix hydrolase 12
7	60711.ENSCSAP00000002685	0.860	Damage-specific DNA binding protein 1, 127kDa
8	60711.ENSCSAP00000007551	0.852	Acts as a tumor suppressor in many tumor types
9	60711.ENSCSAP00000012320	0.788	annotation not available
10	60711.ENSCSAP00000012484	0.768	Bone marrow stromal cell antigen 1
11	60711.ENSCSAP00000007379	0.764	Nicotinamide nucleotide adenylyltransferase 3
12	60711.ENSCSAP00000008815	0.753	Nicotinamide nucleotide adenylyltransferase 2
13	60711.ENSCSAP00000014540	0.752	Upstream binding transcription factor, RNA polymerase I
14	60711.ENSCSAP00000010771	0.750	ELK4, ETS-domain protein (SRF accessory protein 1)
15	60711.ENSCSAP00000012488	0.750	CD38 molecule
16	60711.ENSCSAP00000005710	0.740	Histone deacetylase 11
17	60711.ENSCSAP00000017307	0.724	NAD kinase
18	60711.ENSCSAP00000006343	0.718	MYC proto-oncogene, bHLH transcription factor
19	60711.ENSCSAP00000006132	0.715	Nuclear respiratory factor 1
20	60711.ENSCSAP00000014125	0.675	Polymerase (DNA directed) iota

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017136	1.000	NAD-dependent histone deacetylase activity
GO:0016740	0.983	transferase activity
GO:0016746	0.946	acyltransferase activity
GO:0016747	0.944	acyltransferase activity, transferring groups other than amino-acyl groups
GO:0034739	0.866	histone H4K16 deacetylase activity
GO:0016410	0.740	N-acyltransferase activity
GO:0097372	0.685	NAD-dependent histone H3K18 deacetylase activity
GO:1901363	0.336	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0019222	0.988	regulation of metabolic process
GO:0043170	0.980	macromolecule metabolic process
GO:0019219	0.974	regulation of nucleobase-containing compound metabolic process
GO:0036211	0.962	protein modification process
GO:0060255	0.941	regulation of macromolecule metabolic process
GO:0048519	0.936	negative regulation of biological process
GO:0006476	0.922	protein deacetylation
GO:0016570	0.865	histone modification
GO:0044237	0.840	cellular metabolic process
GO:0050896	0.801	response to stimulus
GO:0048523	0.749	negative regulation of cellular process
GO:0071840	0.725	cellular component organization or biogenesis
GO:0016575	0.718	histone deacetylation
GO:0016043	0.695	cellular component organization
GO:0006950	0.688	response to stress
GO:0051716	0.649	cellular response to stimulus
GO:0048583	0.647	regulation of response to stimulus
GO:0048518	0.595	positive regulation of biological process
GO:0010468	0.590	regulation of gene expression
GO:0033554	0.588	cellular response to stress
GO:0048522	0.559	positive regulation of cellular process
GO:0031326	0.448	regulation of cellular biosynthetic process
GO:0009892	0.427	negative regulation of metabolic process
GO:0009893	0.426	positive regulation of metabolic process
GO:0010556	0.422	regulation of macromolecule biosynthetic process
GO:0010604	0.419	positive regulation of macromolecule metabolic process
GO:0034641	0.414	cellular nitrogen compound metabolic process
GO:0046483	0.413	heterocycle metabolic process
GO:1901360	0.410	organic cyclic compound metabolic process
GO:0006725	0.409	cellular aromatic compound metabolic process
GO:0080134	0.404	regulation of response to stress
GO:0031325	0.400	positive regulation of cellular metabolic process
GO:0006139	0.400	nucleobase-containing compound metabolic process
GO:0006355	0.400	regulation of DNA-templated transcription
GO:0051052	0.399	regulation of DNA metabolic process
GO:0006974	0.385	cellular response to DNA damage stimulus
GO:0080135	0.380	regulation of cellular response to stress
GO:0051173	0.374	positive regulation of nitrogen compound metabolic process
GO:0051128	0.365	regulation of cellular component organization
GO:0010605	0.364	negative regulation of macromolecule metabolic process
GO:0006996	0.349	organelle organization
GO:0031324	0.329	negative regulation of cellular metabolic process
GO:0045935	0.315	positive regulation of nucleobase-containing compound metabolic process
GO:0051172	0.304	negative regulation of nitrogen compound metabolic process
GO:0006282	0.304	regulation of DNA repair

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0005694	0.995	chromosome
GO:0005654	0.992	nucleoplasm
GO:0032991	0.914	protein-containing complex
GO:0000785	0.880	chromatin
GO:0005737	0.845	cytoplasm
GO:0035861	0.810	site of double-strand break
GO:0005829	0.394	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.
EC:2.-.-.-	0.983	Transferases.
EC:2.3.-.-	0.946	Acyltransferases.
EC:2.3.1.-	0.944	Transferring groups other than amino-acyl groups.

[back to server]