StarFunc result for job id Q9NRD1

User Input

>input (293 residues)
MDAPHSKAALDSINELPENILLELFTHVPARQLLLNCRLVCSLWRDLIDLMTLWKRKCLR
EGFITKDWDQPVADWKIFYFLRSLHRNLLRNPCAEEDMFAWQIDFNGGDRWKVESLPGAH
GTDFPDPKVKKYFVTSYEMCLKSQLVDLVAEGYWEELLDTFRPDIVVKDWFAARADCGCT
YQLKVQLASADYFVLASFEPPPVTIQQWNNATWTEVSYTFSDYPRGVRYILFQHGGRDTQ
YWAGWYGPRVTNSSIVVSPKMTRNQASSEAQPGQKHGQEEAAQSPYRAVVQIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRD1	1.000	1.000	3.053E-63	293	1.000	1.000	Q9NRD1.pdb.gz	FBX6_HUMAN F-box only protein 6 OS=Homo sapiens OX=9606 GN=FBXO6 PE=1 SV=1
2	AFDB:Q9QZN4	0.851	0.845	7.438E-48	295	0.679	0.675	Q9QZN4.pdb.gz	FBX6_MOUSE F-box only protein 6 OS=Mus musculus OX=10090 GN=Fbxo6 PE=1 SV=1
3	AFDB:Q8BK26	0.834	0.955	6.564E-43	255	0.628	0.722	Q8BK26.pdb.gz	FBX44_MOUSE F-box only protein 44 OS=Mus musculus OX=10090 GN=Fbxo44 PE=1 SV=1
4	PDB:3wsoA	0.781	0.900	1.118E-37	252	0.648	0.754	3wsoA.pdb.gz
5	AFDB:Q8VD40	0.807	0.789	7.661E-34	300	0.423	0.413	Q8VD40.pdb.gz	Q8VD40_CAVPO F-box protein 2 OS=Cavia porcellus OX=10141 GN=OCP1 PE=2 SV=1
6	AFDB:Q80UW2	0.808	0.798	8.114E-34	297	0.423	0.418	Q80UW2.pdb.gz	FBX2_MOUSE F-box only protein 2 OS=Mus musculus OX=10090 GN=Fbxo2 PE=1 SV=1
7	PDB:2e31A	0.808	0.959	6.227E-33	246	0.427	0.508	2e31A.pdb.gz
8	AFDB:Q9UK22	0.813	0.805	9.085E-33	296	0.437	0.432	Q9UK22.pdb.gz	FBX2_HUMAN F-box only protein 2 OS=Homo sapiens OX=9606 GN=FBXO2 PE=1 SV=2
9	AFDB:Q8NI29	0.605	0.623	3.788E-27	283	0.375	0.389	Q8NI29.pdb.gz	FBX27_HUMAN F-box only protein 27 OS=Homo sapiens OX=9606 GN=FBXO27 PE=1 SV=2
10	AFDB:Q96EF6	0.594	0.622	1.005E-25	278	0.324	0.342	Q96EF6.pdb.gz	FBX17_HUMAN F-box only protein 17 OS=Homo sapiens OX=9606 GN=FBXO17 PE=1 SV=1
11	AFDB:Q17962	0.486	0.392	8.324E-18	384	0.235	0.180	Q17962.pdb.gz	Q17962_CAEEL F-box domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C14B1.3 PE=1 SV=1
12	AFDB:Q6ZVX7	0.446	0.472	9.265E-14	275	0.239	0.255	Q6ZVX7.pdb.gz	FBX50_HUMAN F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1
13	PDB:6vlsD	0.266	0.098	2.941E-3	963	0.082	0.025	6vlsD.pdb.gz
14	PDB:7qe7L	0.185	0.245	3.702E-3	183	0.078	0.126	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:3ffzA	0.241	0.083	5.865E-3	1246	0.089	0.021	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
16	PDB:4pxqA	0.212	0.133	5.865E-3	516	0.089	0.050	4pxqA.pdb.gz	Structural and Functional Study of d-Glucuronyl C5-epimerase.
17	PDB:7z8bC	0.241	0.080	6.579E-3	1224	0.116	0.028	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
18	PDB:7ungXA	0.313	0.456	6.969E-3	186	0.061	0.097	7ungXA.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
19	PDB:4tlgA	0.214	0.167	1.239E-2	396	0.068	0.051	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
20	PDB:1xpwA	0.202	0.320	1.651E-2	143	0.048	0.098	1xpwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRD1	0.0	613	293	1.000	1.000	FBX6_HUMAN F-box only protein 6 OS=Homo sapiens OX=9606 GN=FBXO6 PE=1 SV=1
2	Q9QZN4	1.77e-149	422	295	0.672	0.668	FBX6_MOUSE F-box only protein 6 OS=Mus musculus OX=10090 GN=Fbxo6 PE=1 SV=1
3	Q9H4M3	1.14e-139	395	255	0.648	0.745	FBX44_HUMAN F-box only protein 44 OS=Homo sapiens OX=9606 GN=FBXO44 PE=1 SV=3
4	Q8BK26	2.28e-135	385	255	0.628	0.722	FBX44_MOUSE F-box only protein 44 OS=Mus musculus OX=10090 GN=Fbxo44 PE=1 SV=1
5	Q9UK22	8.06e-81	248	296	0.410	0.405	FBX2_HUMAN F-box only protein 2 OS=Homo sapiens OX=9606 GN=FBXO2 PE=1 SV=2
6	Q80UW2	2.36e-79	244	297	0.403	0.397	FBX2_MOUSE F-box only protein 2 OS=Mus musculus OX=10090 GN=Fbxo2 PE=1 SV=1
7	Q9Z1X8	2.91e-79	244	296	0.406	0.402	Q9Z1X8_RAT Neural F box protein NFB42 OS=Rattus norvegicus OX=10116 GN=Fbxo2 PE=2 SV=1
8	Q8VD40	6.32e-79	243	300	0.403	0.393	Q8VD40_CAVPO F-box protein 2 OS=Cavia porcellus OX=10141 GN=OCP1 PE=2 SV=1
9	A0A8I6AAF5	6.49e-79	243	297	0.406	0.401	A0A8I6AAF5_RAT F-box protein 2 OS=Rattus norvegicus OX=10116 GN=Fbxo2 PE=4 SV=1
10	G3V774	7.48e-79	243	296	0.406	0.402	G3V774_RAT F-box protein 2 OS=Rattus norvegicus OX=10116 GN=Fbxo2 PE=4 SV=1
11	A0A8I5ZK45	8.32e-79	243	305	0.406	0.390	A0A8I5ZK45_RAT F-box protein 2 OS=Rattus norvegicus OX=10116 GN=Fbxo2 PE=4 SV=1
12	A0A8I6A9Y7	1.25e-78	243	309	0.406	0.385	A0A8I6A9Y7_RAT F-box protein 2 OS=Rattus norvegicus OX=10116 GN=Fbxo2 PE=4 SV=1
13	Q8NI29	4.20e-57	187	283	0.352	0.364	FBX27_HUMAN F-box only protein 27 OS=Homo sapiens OX=9606 GN=FBXO27 PE=1 SV=2
14	Q96EF6	6.99e-52	173	278	0.311	0.327	FBX17_HUMAN F-box only protein 17 OS=Homo sapiens OX=9606 GN=FBXO17 PE=1 SV=1
15	W5UTZ0	6.25e-23	96.7	235	0.256	0.319	W5UTZ0_ICTPU F-box only protein 50 OS=Ictalurus punctatus OX=7998 GN=nccrp1 PE=2 SV=1
16	Q9PTD4	3.87e-21	91.7	235	0.256	0.319	Q9PTD4_ICTPU F-box only protein 50 OS=Ictalurus punctatus OX=7998 GN=NCCRP-1 PE=2 SV=1
17	Q6ZVX7	6.49e-18	83.6	275	0.167	0.178	FBX50_HUMAN F-box only protein 50 OS=Homo sapiens OX=9606 GN=NCCRP1 PE=1 SV=1
18	Q17962	3.91e-13	71.2	384	0.154	0.117	Q17962_CAEEL F-box domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C14B1.3 PE=1 SV=1
19	Q9UF56	0.012	39.7	701	0.061	0.026	FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=1 SV=3
20	H7C835	0.017	38.9	463	0.061	0.039	H7C835_HUMAN F-box and leucine-rich repeat protein 17 OS=Homo sapiens OX=9606 GN=FBXL17 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00646 F-box	0.00071	30.6	F-box domain
2	PF12937 F-box-like	2.4e-05	35.4	F-box-like
3	PF04300 FBA	3.6e-71	250.0	F-box associated region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365944

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.992	S-phase kinase-associated protein 1
2	9606.ENSP00000326804	0.982	Cullin-1
3	9606.ENSP00000216225	0.832	E3 ubiquitin-protein ligase RBX1
4	9606.ENSP00000346240	0.817	F-box only protein 2
5	9606.ENSP00000250495	0.686	NEDD8
6	9606.ENSP00000377958	0.658	T-complex protein 1 subunit delta
7	9606.ENSP00000304286	0.646	Forkhead box protein I1
8	9606.ENSP00000235310	0.633	Mitotic spindle assembly checkpoint protein MAD2B
9	9606.ENSP00000258091	0.613	T-complex protein 1 subunit eta
10	9606.ENSP00000275603	0.613	T-complex protein 1 subunit zeta
11	9606.ENSP00000280326	0.613	T-complex protein 1 subunit epsilon
12	9606.ENSP00000286788	0.613	T-complex protein 1 subunit theta
13	9606.ENSP00000295688	0.613	T-complex protein 1 subunit gamma
14	9606.ENSP00000299300	0.613	T-complex protein 1 subunit beta
15	9606.ENSP00000317334	0.613	T-complex protein 1 subunit alpha
16	9606.ENSP00000380256	0.607	Cyclin-F
17	9606.ENSP00000327191	0.600	T-complex protein 1 subunit zeta-2
18	9606.ENSP00000281708	0.595	F-box/WD repeat-containing protein 7
19	9606.ENSP00000345528	0.570	Solute carrier family 35 member F6
20	9606.ENSP00000281623	0.560	F-box only protein 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.540	catalytic activity
GO:0016740	0.512	transferase activity
GO:0140096	0.490	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.994	cellular metabolic process
GO:0043170	0.989	macromolecule metabolic process
GO:1901564	0.988	organonitrogen compound metabolic process
GO:0050794	0.981	regulation of cellular process
GO:0019538	0.968	protein metabolic process
GO:0051716	0.964	cellular response to stimulus
GO:0044260	0.963	cellular macromolecule metabolic process
GO:0051603	0.934	proteolysis involved in protein catabolic process
GO:0043161	0.917	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0031146	0.846	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0033554	0.790	cellular response to stress
GO:0048523	0.754	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0031461	0.998	cullin-RING ubiquitin ligase complex
GO:0019005	0.994	SCF ubiquitin ligase complex
GO:0043231	0.904	intracellular membrane-bounded organelle
GO:0012505	0.562	endomembrane system
GO:0070013	0.476	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.512	Transferases.

[back to server]