StarFunc result for job id Q9NRD8

User Input

>input (1548 residues)
MLRARPEALMLLGALLTGSLGPSGNQDALSLPWEVQRYDGWFNNLRHHERGAVGCRLQRR
VPANYADGVYQALEEPQLPNPRRLSNAATRGIAGLPSLHNRTVLGVFFGYHVLSDVVSVE
TPGCPAEFLNIRIPPGDPVFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDLANQVTGWLD
GSAIYGSSHSWSDALRSFSGGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAF
GAERGNREPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYE
WLPSFLQKTLPEYTGYRPFLDPSISPEFVVASEQFFSTMVPPGVYMRNASCHFRKVLNKG
FQSSQALRVCNNYWIRENPNLNSTQEVNELLLGMASQISELEDNIVVEDLRDYWPGPGKF
SRTDYVASSIQRGRDMGLPSYSQALLAFGLDIPRNWSDLNPNVDPQVLEATAALYNQDLS
QLELLLGGLLESHGDPGPLFSAIVLDQFVRLRDGDRYWFENTRNGLFSKKEIEDIRNTTL
RDVLVAVINIDPSALQPNVFVWHKGAPCPQPKQLTTDGLPQCAPLTVLDFFEGSSPGFAI
TIIALCCLPLVSLLLSGVVAYFRGREHKKLQKKLKESVKKEAAKDGVPAMEWPGPKERSS
PIIIQLLSDRCLQVLNRHLTVLRVVQLQPLQQVNLILSNNRGCRTLLLKIPKEYDLVLLF
SSEEERGAFVQQLWDFCVRWALGLHVAEMSEKELFRKAVTKQQRERILEIFFRHLFAQVL
DINQADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLS
FREFLDILVVFMKGSPEDKSRLMFTMYDLDENGFLSKDEFFTMMRSFIEISNNCLSKAQL
AEVVESMFRESGFQDKEELTWEDFHFMLRDHDSELRFTQLCVKGGGGGGNGIRDIFKQNI
SCRVSFITRTPGERSHPQGLGPPAPEAPELGGPGLKKRFGKKAAVPTPRLYTEALQEKMQ
RGFLAQKLQQYKRFVENYRRHIVCVAIFSAICVGVFADRAYYYGFASPPSDIAQTTLVGI
ILSRGTAASVSFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRWIAMAAVVLAIL
HSAGHAVNVYIFSVSPLSLLACIFPNVFVNDGSKLPQKFYWWFFQTVPGMTGVLLLLVLA
IMYVFASHHFRRRSFRGFWLTHHLYILLYALLIIHGSYALIQLPTFHIYFLVPAIIYGGD
KLVSLSRKKVEISVVKAELLPSGVTYLQFQRPQGFEYKSGQWVRIACLALGTTEYHPFTL
TSAPHEDTLSLHIRAVGPWTTRLREIYSSPKGNGCAGYPKLYLDGPFGEGHQEWHKFEVS
VLVGGGIGVTPFASILKDLVFKSSLGSQMLCKKIYFIWVTRTQRQFEWLADIIQEVEEND
HQDLVSVHIYVTQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEPFFN
SLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLVNRQDRAHFMHHYENF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494BAW1	0.940	0.942	0.000	1545	0.849	0.850	A0A494BAW1.pdb.gz	A0A494BAW1_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=1 SV=1
2	AFDB:A2AQ92	0.923	0.921	0.000	1551	0.751	0.749	A2AQ92.pdb.gz	A2AQ92_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox1 PE=1 SV=1
3	AFDB:F1QVF2	0.915	0.932	0.000	1519	0.532	0.542	F1QVF2.pdb.gz
4	AFDB:O01795	0.764	0.784	0.000	1503	0.344	0.355	O01795.pdb.gz	O01795_CAEEL NAD(P)H oxidase (H2O2-forming) OS=Caenorhabditis elegans OX=6239 GN=duox-2 PE=3 SV=2
5	AFDB:Q9ES45	0.951	0.970	0.000	1517	0.825	0.842	Q9ES45.pdb.gz	DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus OX=10116 GN=Duox2 PE=2 SV=1
6	AFDB:Q9NRD8	1.000	1.000	0.000	1548	1.000	1.000	Q9NRD8.pdb.gz	DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens OX=9606 GN=DUOX2 PE=1 SV=2
7	AFDB:Q9VQH2	0.812	0.818	0.000	1537	0.375	0.377	Q9VQH2.pdb.gz	DUOX_DROME Dual oxidase OS=Drosophila melanogaster OX=7227 GN=Duox PE=1 SV=2
8	AFDB:A0A2R8QJC5	0.259	0.880	1.324E-39	450	0.138	0.476	A0A2R8QJC5.pdb.gz
9	AFDB:O81210	0.316	0.486	1.389E-37	905	0.136	0.232	O81210.pdb.gz	RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana OX=3702 GN=RBOHC PE=2 SV=2
10	AFDB:Q96PH1	0.284	0.493	1.591E-37	765	0.131	0.265	Q96PH1.pdb.gz	NOX5_HUMAN NADPH oxidase 5 OS=Homo sapiens OX=9606 GN=NOX5 PE=1 SV=1
11	PDB:5mfaA	0.303	0.769	2.328E-25	588	0.091	0.240	5mfaA.pdb.gz	Structure of human promyeloperoxidase (proMPO) and the role of the propeptide in processing and maturation.
12	PDB:4hhrA	0.280	0.646	1.641E-18	640	0.060	0.145	4hhrA.pdb.gz	The crystal structure of alpha-Dioxygenase provides insight into diversity in the cyclooxygenase-peroxidase superfamily.
13	PDB:5f1aA	0.221	0.576	1.263E-12	553	0.052	0.145	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
14	PDB:4rs0A	0.231	0.591	1.447E-12	557	0.054	0.151	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
15	PDB:6y3cA	0.217	0.562	2.980E-12	557	0.057	0.160	6y3cA.pdb.gz
16	PDB:1gvhA	0.141	0.474	1.741E-9	396	0.047	0.184	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
17	PDB:1cqxA	0.132	0.401	1.667E-8	403	0.043	0.166	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
18	PDB:1fdrA	0.126	0.664	4.713E-8	244	0.025	0.156	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.
19	PDB:1qfjA	0.116	0.623	6.180E-8	226	0.026	0.181	1qfjA.pdb.gz
20	PDB:3crzA	0.127	0.633	1.063E-7	257	0.028	0.167	3crzA.pdb.gz	X-ray crystallographic and solution state nuclear magnetic resonance spectroscopic investigations of NADP+ binding to ferredoxin NADP reductase from Pseudomonas aeruginosa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494BAW1	0.0	2722	1545	0.849	0.850	A0A494BAW1_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=1 SV=1
2	A2AQ92	0.0	2352	1551	0.756	0.754	A2AQ92_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox1 PE=1 SV=1
3	A2AQ99	0.0	2682	1517	0.839	0.856	A2AQ99_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=1 SV=1
4	B7ZWM4	0.0	2714	1545	0.847	0.849	B7ZWM4_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=2 SV=1
5	O01795	0.0	927	1503	0.352	0.363	O01795_CAEEL NAD(P)H oxidase (H2O2-forming) OS=Caenorhabditis elegans OX=6239 GN=duox-2 PE=3 SV=2
6	O61213	0.0	947	1497	0.356	0.368	DUOX1_CAEEL Dual oxidase 1 OS=Caenorhabditis elegans OX=6239 GN=bli-3 PE=1 SV=2
7	Q8BZ02	0.0	1618	1058	0.519	0.759	Q8BZ02_MOUSE NAD(P)H oxidase (H2O2-forming) (Fragment) OS=Mus musculus OX=10090 GN=Duox1 PE=2 SV=1
8	Q9ES45	0.0	2624	1517	0.826	0.842	DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus OX=10116 GN=Duox2 PE=2 SV=1
9	Q9NRD8	0.0	3199	1548	1.000	1.000	DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens OX=9606 GN=DUOX2 PE=1 SV=2
10	Q9NRD9	0.0	2422	1551	0.780	0.778	DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens OX=9606 GN=DUOX1 PE=1 SV=1
11	Q9VQH2	0.0	1101	1537	0.378	0.381	DUOX_DROME Dual oxidase OS=Drosophila melanogaster OX=7227 GN=Duox PE=1 SV=2
12	Q8BV64	2.03e-98	317	232	0.097	0.647	Q8BV64_MOUSE Ferric oxidoreductase domain-containing protein OS=Mus musculus OX=10090 GN=Duox2 PE=2 SV=1
13	Q9FIJ0	1.09e-90	318	921	0.139	0.233	RBOHD_ARATH Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana OX=3702 GN=RBOHD PE=1 SV=1
14	Q948T9	3.73e-89	313	867	0.121	0.216	RBOHB_SOLTU Respiratory burst oxidase homolog protein B OS=Solanum tuberosum OX=4113 GN=RBOHB PE=1 SV=1
15	O81210	1.38e-85	303	905	0.111	0.190	RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana OX=3702 GN=RBOHC PE=2 SV=2
16	O81209	8.76e-85	301	902	0.121	0.208	RBOHA_ARATH Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana OX=3702 GN=RBOHA PE=2 SV=2
17	O48538	2.41e-84	300	944	0.119	0.195	RBOHF_ARATH Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana OX=3702 GN=RBOHF PE=1 SV=1
18	Q9XYS3	4.40e-81	279	517	0.108	0.323	NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum OX=44689 GN=noxA PE=2 SV=1
19	Q5ZAJ0	1.72e-80	288	905	0.114	0.194	RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica OX=39947 GN=RBOHB PE=1 SV=1
20	Q9SBI0	2.58e-80	286	843	0.107	0.197	RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana OX=3702 GN=RBOHB PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03098 An_peroxidase	4.4e-137	469.5	Animal haem peroxidase
2	PF00036 EF-hand_1	7.3e-09	45.6	EF hand
3	PF12763 EF-hand_4	4.9e+02	12.1	Cytoskeletal-regulatory complex EF hand
4	PF13202 EF-hand_5	0.016	25.9	EF hand
5	PF13405 EF-hand_6	0.00014	32.4	EF-hand domain
6	PF13499 EF-hand_7	4.1e-05	35.3	EF-hand domain pair
7	PF13833 EF-hand_8	0.00023	32.2	EF-hand domain pair
8	PF08022 FAD_binding_8	1.2e-14	65.7	FAD-binding domain
9	PF01794 Ferric_reduct	4.8e-16	70.4	Ferric reductase like transmembrane component
10	PF00175 NAD_binding_1	3.5	19.7	Oxidoreductase NAD-binding domain
11	PF08030 NAD_binding_6	2.4e-27	107.5	Ferric reductase NAD binding domain
12	PF18993 Rv0078B	3e+02	12.8	Rv0078B-related antitoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000475084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319705	0.999	Dual oxidase maturation factor 2
2	9606.ENSP00000267803	0.980	Dual oxidase maturation factor 1
3	9606.ENSP00000261623	0.896	Cytochrome b-245 light chain
4	9606.ENSP00000289473	0.890	Neutrophil cytosol factor 1
5	9606.ENSP00000356505	0.866	Neutrophil cytosol factor 2
6	9606.ENSP00000300589	0.855	Nucleotide-binding oligomerization domain-containing protein 2
7	9606.ENSP00000380450	0.845	NADPH oxidase organizer 1
8	9606.ENSP00000342848	0.839	NADPH oxidase activator 1
9	9606.ENSP00000380334	0.830	Neutrophil cytosol factor 4
10	9606.ENSP00000317997	0.812	Dual oxidase 1
11	9606.ENSP00000229447	0.742	Iodotyrosine deiodinase 1
12	9606.ENSP00000263317	0.730	NADPH oxidase 4
13	9606.ENSP00000222248	0.724	Sodium/iodide cotransporter
14	9606.ENSP00000357905	0.724	Deleted in malignant brain tumors 1 protein
15	9606.ENSP00000315006	0.720	Sodium/nucleoside cotransporter 2
16	9606.ENSP00000241052	0.706	Catalase
17	9606.ENSP00000261867	0.686	Zinc transporter 4
18	9606.ENSP00000373518	0.664	NADPH oxidase 5
19	9606.ENSP00000265715	0.658	Pendrin
20	9606.ENSP00000379895	0.658	Glycine amidinotransferase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050664	1.000	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
GO:0043167	0.908	ion binding
GO:0046872	0.885	metal ion binding
GO:0005509	0.880	calcium ion binding
GO:0016174	0.396	NAD(P)H oxidase H2O2-forming activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0008152	0.995	metabolic process
GO:0065007	0.992	biological regulation
GO:0044237	0.988	cellular metabolic process
GO:0071704	0.981	organic substance metabolic process
GO:0006575	0.951	cellular modified amino acid metabolic process
GO:0042445	0.898	hormone metabolic process
GO:0018958	0.888	phenol-containing compound metabolic process
GO:0050794	0.865	regulation of cellular process
GO:0050896	0.846	response to stimulus
GO:0072593	0.713	reactive oxygen species metabolic process
GO:0032501	0.700	multicellular organismal process
GO:0032502	0.671	developmental process
GO:0048856	0.662	anatomical structure development
GO:0048518	0.573	positive regulation of biological process
GO:0042221	0.560	response to chemical
GO:0048522	0.535	positive regulation of cellular process
GO:0007275	0.530	multicellular organism development
GO:0051716	0.520	cellular response to stimulus
GO:0070887	0.427	cellular response to chemical stimulus
GO:0048583	0.341	regulation of response to stimulus
GO:0042403	0.333	thyroid hormone metabolic process
GO:0010033	0.322	response to organic substance
GO:0006950	0.319	response to stress
GO:1901700	0.316	response to oxygen-containing compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.998	endomembrane system
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005737	0.964	cytoplasm
GO:0005576	0.799	extracellular region
GO:0031982	0.778	vesicle
GO:0065010	0.639	extracellular membrane-bounded organelle
GO:0005615	0.631	extracellular space
GO:0005783	0.599	endoplasmic reticulum
GO:1903561	0.585	extracellular vesicle
GO:0009986	0.571	cell surface
GO:0031252	0.534	cell leading edge
GO:0005829	0.519	cytosol
GO:0070062	0.454	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.6.3.-	1.000	With oxygen as acceptor.
EC:1.6.3.1	0.396	NAD(P)H oxidase (H2O2-forming).

[back to server]