StarFunc result for job id Q9NRD9

User Input

>input (1551 residues)
MGFCLALAWTLLVGAWTPLGAQNPISWEVQRFDGWYNNLMEHRWGSKGSRLQRLVPASYA
DGVYQPLGEPHLPNPRDLSNTISRGPAGLASLRNRTVLGVFFGYHVLSDLVSVETPGCPA
EFLNIRIPPGDPMFDPDQRGDVVLPFQRSRWDPETGRSPSNPRDPANQVTGWLDGSAIYG
SSHSWSDALRSFSRGQLASGPDPAFPRDSQNPLLMWAAPDPATGQNGPRGLYAFGAERGN
REPFLQALGLLWFRYHNLWAQRLARQHPDWEDEELFQHARKRVIATYQNIAVYEWLPSFL
QKTLPEYTGYRPFLDPSISSEFVAASEQFLSTMVPPGVYMRNASCHFQGVINRNSSVSRA
LRVCNSYWSREHPSLQSAEDVDALLLGMASQIAEREDHVLVEDVRDFWPGPLKFSRTDHL
ASCLQRGRDLGLPSYTKARAALGLSPITRWQDINPALSRSNDTVLEATAALYNQDLSWLE
LLPGGLLESHRDPGPLFSTIVLEQFVRLRDGDRYWFENTRNGLFSKKEIEEIRNTTLQDV
LVAVINIDPSALQPNVFVWHKGDPCPQPRQLSTEGLPACAPSVVRDYFEGSGFGFGVTIG
TLCCFPLVSLLSAWIVARLRMRNFKRLQGQDRQSIVSEKLVGGMEALEWQGHKEPCRPVL
VYLQPGQIRVVDGRLTVLRTIQLQPPQKVNFVLSSNRGRRTLLLKIPKEYDLVLLFNLEE
ERQALVENLRGALKESGLSIQEWELREQELMRAAVTREQRRHLLETFFRHLFSQVLDINQ
ADAGTLPLDSSQKVREALTCELSRAEFAESLGLKPQDMFVESMFSLADKDGNGYLSFREF
LDILVVFMKGSPEEKSRLMFRMYDFDGNGLISKDEFIRMLRSFIEISNNCLSKAQLAEVV
ESMFRESGFQDKEELTWEDFHFMLRDHNSELRFTQLCVKGVEVPEVIKDLCRRASYISQD
MICPSPRVSARCSRSDIETELTPQRLQCPMDTDPPQEIRRRFGKKVTSFQPLLFTEAHRE
KFQRSCLHQTVQQFKRFIENYRRHIGCVAVFYAIAGGLFLERAYYYAFAAHHTGITDTTR
VGIILSRGTAASISFMFSYILLTMCRNLITFLRETFLNRYVPFDAAVDFHRLIASTAIVL
TVLHSVGHVVNVYLFSISPLSVLSCLFPGLFHDDGSELPQKYYWWFFQTVPGLTGVVLLL
ILAIMYVFASHHFRRRSFRGFWLTHHLYILLYVLLIIHGSFALIQLPRFHIFFLVPAIIY
GGDKLVSLSRKKVEISVVKAELLPSGVTHLRFQRPQGFEYKSGQWVRIACLALGTTEYHP
FTLTSAPHEDTLSLHIRAAGPWTTRLREIYSAPTGDRCARYPKLYLDGPFGEGHQEWHKF
EVSVLVGGGIGVTPFASILKDLVFKSSVSCQVFCKKIYFIWVTRTQRQFEWLADIIREVE
ENDHQDLVSVHIYITQLAEKFDLRTTMLYICERHFQKVLNRSLFTGLRSITHFGRPPFEP
FFNSLQEVHPQVRKIGVFSCGPPGMTKNVEKACQLINRQDRTHFSHHYENF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A494BAW1	0.936	0.940	0.000	1545	0.746	0.749	A0A494BAW1.pdb.gz	A0A494BAW1_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=1 SV=1
2	AFDB:A2AQ92	0.983	0.983	0.000	1551	0.910	0.910	A2AQ92.pdb.gz	A2AQ92_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox1 PE=1 SV=1
3	AFDB:F1QVF2	0.905	0.924	0.000	1519	0.552	0.564	F1QVF2.pdb.gz
4	AFDB:O01795	0.761	0.782	0.000	1503	0.330	0.341	O01795.pdb.gz	O01795_CAEEL NAD(P)H oxidase (H2O2-forming) OS=Caenorhabditis elegans OX=6239 GN=duox-2 PE=3 SV=2
5	AFDB:Q9ES45	0.931	0.951	0.000	1517	0.741	0.758	Q9ES45.pdb.gz	DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus OX=10116 GN=Duox2 PE=2 SV=1
6	AFDB:Q9NRD8	0.919	0.921	0.000	1548	0.776	0.778	Q9NRD8.pdb.gz	DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens OX=9606 GN=DUOX2 PE=1 SV=2
7	AFDB:Q9VQH2	0.784	0.791	0.000	1537	0.393	0.396	Q9VQH2.pdb.gz	DUOX_DROME Dual oxidase OS=Drosophila melanogaster OX=7227 GN=Duox PE=1 SV=2
8	AFDB:A0A2R8QJC5	0.259	0.882	2.379E-39	450	0.139	0.478	A0A2R8QJC5.pdb.gz
9	AFDB:Q9SW17	0.305	0.486	2.828E-38	849	0.131	0.239	Q9SW17.pdb.gz	RBOHG_ARATH Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana OX=3702 GN=RBOHG PE=3 SV=2
10	AFDB:O81210	0.315	0.482	8.329E-38	905	0.141	0.241	O81210.pdb.gz	RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana OX=3702 GN=RBOHC PE=2 SV=2
11	PDB:5mfaA	0.308	0.784	3.881E-26	588	0.094	0.248	5mfaA.pdb.gz	Structure of human promyeloperoxidase (proMPO) and the role of the propeptide in processing and maturation.
12	PDB:4hhrA	0.278	0.644	2.370E-20	640	0.066	0.159	4hhrA.pdb.gz	The crystal structure of alpha-Dioxygenase provides insight into diversity in the cyclooxygenase-peroxidase superfamily.
13	PDB:5f1aA	0.221	0.573	1.314E-13	553	0.054	0.150	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
14	PDB:4rs0A	0.232	0.601	1.504E-13	557	0.055	0.154	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
15	PDB:6y3cA	0.231	0.600	3.090E-13	557	0.064	0.178	6y3cA.pdb.gz
16	PDB:1gvhA	0.141	0.467	3.002E-9	396	0.043	0.167	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
17	PDB:1cqxA	0.130	0.393	6.453E-9	403	0.042	0.161	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
18	PDB:1qfjA	0.115	0.621	2.490E-8	226	0.026	0.181	1qfjA.pdb.gz
19	PDB:1fdrA	0.124	0.641	7.011E-8	244	0.024	0.152	1fdrA.pdb.gz	The three-dimensional structure of flavodoxin reductase from Escherichia coli at 1.7 A resolution.
20	PDB:7romA	0.123	0.601	8.394E-8	255	0.025	0.153	7romA.pdb.gz	Crystal structure of Saccharomyces cerevisiae NADH-cytochrome b5 reductase 1 (Cbr1) fragment (residues 28-284) bound to FAD

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A494BAW1	0.0	2354	1545	0.751	0.754	A0A494BAW1_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=1 SV=1
2	A2AQ92	0.0	2898	1551	0.910	0.910	A2AQ92_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox1 PE=1 SV=1
3	A2AQ99	0.0	2334	1517	0.745	0.762	A2AQ99_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=1 SV=1
4	B7ZWM4	0.0	2349	1545	0.750	0.753	B7ZWM4_MOUSE NAD(P)H oxidase (H2O2-forming) OS=Mus musculus OX=10090 GN=Duox2 PE=2 SV=1
5	O01795	0.0	906	1503	0.342	0.353	O01795_CAEEL NAD(P)H oxidase (H2O2-forming) OS=Caenorhabditis elegans OX=6239 GN=duox-2 PE=3 SV=2
6	O61213	0.0	943	1497	0.351	0.363	DUOX1_CAEEL Dual oxidase 1 OS=Caenorhabditis elegans OX=6239 GN=bli-3 PE=1 SV=2
7	Q8BZ02	0.0	2038	1058	0.636	0.932	Q8BZ02_MOUSE NAD(P)H oxidase (H2O2-forming) (Fragment) OS=Mus musculus OX=10090 GN=Duox1 PE=2 SV=1
8	Q9ES45	0.0	2316	1517	0.740	0.756	DUOX2_RAT Dual oxidase 2 OS=Rattus norvegicus OX=10116 GN=Duox2 PE=2 SV=1
9	Q9NRD8	0.0	2417	1548	0.778	0.780	DUOX2_HUMAN Dual oxidase 2 OS=Homo sapiens OX=9606 GN=DUOX2 PE=1 SV=2
10	Q9NRD9	0.0	3203	1551	1.000	1.000	DUOX1_HUMAN Dual oxidase 1 OS=Homo sapiens OX=9606 GN=DUOX1 PE=1 SV=1
11	Q9VQH2	0.0	1112	1537	0.395	0.399	DUOX_DROME Dual oxidase OS=Drosophila melanogaster OX=7227 GN=Duox PE=1 SV=2
12	Q948T9	7.70e-95	329	867	0.124	0.221	RBOHB_SOLTU Respiratory burst oxidase homolog protein B OS=Solanum tuberosum OX=4113 GN=RBOHB PE=1 SV=1
13	Q9FIJ0	1.95e-93	327	921	0.143	0.241	RBOHD_ARATH Respiratory burst oxidase homolog protein D OS=Arabidopsis thaliana OX=3702 GN=RBOHD PE=1 SV=1
14	O81210	8.29e-87	306	905	0.116	0.199	RBOHC_ARATH Respiratory burst oxidase homolog protein C OS=Arabidopsis thaliana OX=3702 GN=RBOHC PE=2 SV=2
15	O81209	3.66e-85	302	902	0.126	0.217	RBOHA_ARATH Respiratory burst oxidase homolog protein A OS=Arabidopsis thaliana OX=3702 GN=RBOHA PE=2 SV=2
16	Q5ZAJ0	5.59e-84	298	905	0.134	0.230	RBOHB_ORYSJ Respiratory burst oxidase homolog protein B OS=Oryza sativa subsp. japonica OX=39947 GN=RBOHB PE=1 SV=1
17	O48538	3.17e-83	297	944	0.116	0.191	RBOHF_ARATH Respiratory burst oxidase homolog protein F OS=Arabidopsis thaliana OX=3702 GN=RBOHF PE=1 SV=1
18	Q9SBI0	4.15e-83	294	843	0.113	0.208	RBOHB_ARATH Respiratory burst oxidase homolog protein B OS=Arabidopsis thaliana OX=3702 GN=RBOHB PE=2 SV=1
19	Q9SW17	5.49e-82	291	849	0.126	0.230	RBOHG_ARATH Putative respiratory burst oxidase homolog protein G OS=Arabidopsis thaliana OX=3702 GN=RBOHG PE=3 SV=2
20	Q9XYS3	2.55e-79	274	517	0.107	0.321	NOXA_DICDI Superoxide-generating NADPH oxidase heavy chain subunit A OS=Dictyostelium discoideum OX=44689 GN=noxA PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03098 An_peroxidase	2.6e-139	476.9	Animal haem peroxidase
2	PF00036 EF-hand_1	3.7e-11	52.8	EF hand
3	PF13202 EF-hand_5	0.00021	31.8	EF hand
4	PF13405 EF-hand_6	1.8e-08	44.6	EF-hand domain
5	PF13499 EF-hand_7	9.4e-08	43.7	EF-hand domain pair
6	PF13833 EF-hand_8	2.3e-07	41.8	EF-hand domain pair
7	PF08022 FAD_binding_8	1.4e-14	65.4	FAD-binding domain
8	PF01794 Ferric_reduct	7.3e-15	66.6	Ferric reductase like transmembrane component
9	PF00175 NAD_binding_1	4.8	19.2	Oxidoreductase NAD-binding domain
10	PF08030 NAD_binding_6	9.7e-27	105.5	Ferric reductase NAD binding domain
11	PF18993 Rv0078B	2e+02	13.4	Rv0078B-related antitoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317997

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319705	0.996	Dual oxidase maturation factor 2
2	9606.ENSP00000267803	0.994	Dual oxidase maturation factor 1
3	9606.ENSP00000261623	0.978	Cytochrome b-245 light chain
4	9606.ENSP00000356505	0.940	Neutrophil cytosol factor 2
5	9606.ENSP00000289473	0.929	Neutrophil cytosol factor 1
6	9606.ENSP00000342848	0.926	NADPH oxidase activator 1
7	9606.ENSP00000380334	0.908	Neutrophil cytosol factor 4
8	9606.ENSP00000380450	0.891	NADPH oxidase organizer 1
9	9606.ENSP00000283033	0.856	Thioredoxin domain-containing protein 11
10	9606.ENSP00000475084	0.812	Dual oxidase 2
11	9606.ENSP00000241052	0.749	Catalase
12	9606.ENSP00000315006	0.737	Sodium/nucleoside cotransporter 2
13	9606.ENSP00000261867	0.736	Zinc transporter 4
14	9606.ENSP00000263317	0.733	NADPH oxidase 4
15	9606.ENSP00000379895	0.726	Glycine amidinotransferase, mitochondrial
16	9606.ENSP00000373518	0.671	NADPH oxidase 5
17	9606.ENSP00000367851	0.647	Cytochrome b-245 heavy chain
18	9606.ENSP00000362057	0.645	NADPH oxidase 1
19	9606.ENSP00000159060	0.639	NADPH oxidase 3
20	9606.ENSP00000297494	0.626	Nitric oxide synthase, endothelial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.998	catalytic activity
GO:0016491	0.994	oxidoreductase activity
GO:0016651	0.973	oxidoreductase activity, acting on NAD(P)H
GO:0050664	0.930	oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor
GO:0043167	0.896	ion binding
GO:0043169	0.855	cation binding
GO:0005509	0.842	calcium ion binding
GO:0016174	0.466	NAD(P)H oxidase H2O2-forming activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.990	organic substance metabolic process
GO:0065007	0.989	biological regulation
GO:0072593	0.967	reactive oxygen species metabolic process
GO:0006807	0.935	nitrogen compound metabolic process
GO:0006575	0.932	cellular modified amino acid metabolic process
GO:0050896	0.894	response to stimulus
GO:0050789	0.876	regulation of biological process
GO:0065008	0.860	regulation of biological quality
GO:0010817	0.848	regulation of hormone levels
GO:0050794	0.830	regulation of cellular process
GO:0032501	0.755	multicellular organismal process
GO:0042445	0.730	hormone metabolic process
GO:0048518	0.726	positive regulation of biological process
GO:0018958	0.719	phenol-containing compound metabolic process
GO:0032502	0.705	developmental process
GO:0048522	0.637	positive regulation of cellular process
GO:0042221	0.618	response to chemical
GO:0048856	0.587	anatomical structure development
GO:0051716	0.582	cellular response to stimulus
GO:0007275	0.529	multicellular organism development
GO:0070887	0.515	cellular response to chemical stimulus
GO:0006950	0.451	response to stress
GO:0042403	0.368	thyroid hormone metabolic process
GO:0010033	0.352	response to organic substance
GO:1901700	0.351	response to oxygen-containing compound
GO:0048583	0.344	regulation of response to stimulus
GO:0007154	0.330	cell communication
GO:0023052	0.326	signaling
GO:0048584	0.321	positive regulation of response to stimulus
GO:0007165	0.306	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0012505	0.995	endomembrane system
GO:0043227	0.990	membrane-bounded organelle
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0005737	0.972	cytoplasm
GO:0031982	0.907	vesicle
GO:0005783	0.547	endoplasmic reticulum
GO:0031252	0.510	cell leading edge
GO:0009986	0.510	cell surface
GO:0005576	0.314	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.994	Oxidoreductases.
EC:1.6.-.-	0.973	Acting on NADH or NADPH.
EC:1.6.3.-	0.930	With oxygen as acceptor.
EC:1.6.3.1	0.466	NAD(P)H oxidase (H2O2-forming).

[back to server]