StarFunc result for job id Q9NRE1

User Input

>input (261 residues)
MQLVILRVTIFLPWCFAVPVPPAADHKGWDFVEGYFHQFFLTKKESPLLTQETQTQLLQQ
FHRNGTDLLDMQMHALLHQPHCGVPDGSDTSISPGRCKWNKHTLTYRIINYPHDMKPSAV
KDSIYNAVSIWSNVTPLIFQQVQNGDADIKVSFWQWAHEDGWPFDGPGGILGHAFLPNSG
NPGVVHFDKNEHWSASDTGYNLFLVATHEIGHSLGLQHSGNQSSIMYPTYWYHDPRTFQL
SADDIQRIQHLYGEKCSSDIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NRE1	1.000	1.000	6.707E-59	261	1.000	1.000	Q9NRE1.pdb.gz	MMP26_HUMAN Matrix metalloproteinase-26 OS=Homo sapiens OX=9606 GN=MMP26 PE=2 SV=2
2	AFDB:P45452	0.811	0.457	3.202E-30	471	0.406	0.225	P45452.pdb.gz	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
3	AFDB:P09237	0.828	0.810	4.372E-29	267	0.387	0.378	P09237.pdb.gz	MMP7_HUMAN Matrilysin OS=Homo sapiens OX=9606 GN=MMP7 PE=1 SV=1
4	AFDB:P50280	0.827	0.809	5.608E-29	267	0.395	0.386	P50280.pdb.gz	MMP7_RAT Matrilysin OS=Rattus norvegicus OX=10116 GN=Mmp7 PE=2 SV=1
5	AFDB:P39900	0.819	0.464	1.947E-28	470	0.441	0.245	P39900.pdb.gz	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
6	AFDB:B0JZI6	0.789	0.444	2.072E-28	476	0.410	0.225	B0JZI6.pdb.gz
7	AFDB:P33435	0.830	0.469	2.498E-28	472	0.398	0.220	P33435.pdb.gz	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1
8	AFDB:O55123	0.795	0.446	2.658E-28	476	0.418	0.229	O55123.pdb.gz	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
9	AFDB:P34960	0.816	0.462	3.204E-28	473	0.448	0.247	P34960.pdb.gz	MMP12_MOUSE Macrophage metalloelastase OS=Mus musculus OX=10090 GN=Mmp12 PE=1 SV=3
10	AFDB:Q63341	0.803	0.463	8.673E-28	465	0.429	0.241	Q63341.pdb.gz	MMP12_RAT Macrophage metalloelastase OS=Rattus norvegicus OX=10116 GN=Mmp12 PE=2 SV=1
11	PDB:1su3B	0.758	0.482	2.125E-24	416	0.360	0.226	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
12	PDB:2mzeA	0.774	0.805	2.903E-21	250	0.345	0.360	2mzeA.pdb.gz	Charge-Triggered Membrane Insertion of Matrix Metalloproteinase-7, Supporter of Innate Immunity and Tumors.
13	PDB:1gxdA	0.788	0.343	5.761E-18	624	0.383	0.160	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
14	PDB:1aklA	0.443	0.256	1.564E-7	470	0.184	0.102	1aklA.pdb.gz	Crystal structure of the unliganded alkaline protease from Pseudomonas aeruginosa IFO3080 and its conformational changes on ligand binding.
15	PDB:1af0A	0.406	0.237	2.271E-7	470	0.165	0.091	1af0A.pdb.gz	Kinetic characterization of the serralysins: a divergent catalytic mechanism pertaining to astacin-type metalloproteases.
16	PDB:2x7mA	0.307	0.415	2.136E-4	180	0.088	0.128	2x7mA.pdb.gz	Crystal Structure of Archaemetzincin Amza from Methanopyrus Kandleri at 1.5A Resolution.
17	PDB:4l63A	0.360	0.375	3.981E-3	249	0.153	0.161	4l63A.pdb.gz	EcxAB Is a Founding Member of a New Family of Metalloprotease AB5 Toxins with a Hybrid Cholera-like B Subunit.
18	PDB:2b3xA	0.136	0.045	2.275E-1	888	0.027	0.008	2b3xA.pdb.gz	Crystal structure of human iron regulatory protein 1 as cytosolic aconitase
19	PDB:1kxjA	0.147	0.181	3.105E-1	203	0.031	0.039	1kxjA.pdb.gz
20	PDB:6gs2A	0.127	0.132	3.105E-1	246	0.034	0.037	6gs2A.pdb.gz	Structural basis of cell wall peptidoglycan amidation by the GatD/MurT complex of Staphylococcus aureus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NRE1	0.0	545	261	1.000	1.000	MMP26_HUMAN Matrix metalloproteinase-26 OS=Homo sapiens OX=9606 GN=MMP26 PE=2 SV=2
2	P09237	2.38e-61	196	267	0.387	0.378	MMP7_HUMAN Matrilysin OS=Homo sapiens OX=9606 GN=MMP7 PE=1 SV=1
3	P50280	3.19e-61	196	267	0.402	0.393	MMP7_RAT Matrilysin OS=Rattus norvegicus OX=10116 GN=Mmp7 PE=2 SV=1
4	P34960	5.64e-61	201	473	0.437	0.241	MMP12_MOUSE Macrophage metalloelastase OS=Mus musculus OX=10090 GN=Mmp12 PE=1 SV=3
5	O55123	1.23e-60	200	476	0.429	0.235	MMP10_MOUSE Stromelysin-2 OS=Mus musculus OX=10090 GN=Mmp10 PE=2 SV=1
6	Q63341	1.15e-59	197	465	0.425	0.239	MMP12_RAT Macrophage metalloelastase OS=Rattus norvegicus OX=10116 GN=Mmp12 PE=2 SV=1
7	O70138	1.04e-58	195	465	0.395	0.222	MMP8_MOUSE Neutrophil collagenase OS=Mus musculus OX=10090 GN=Mmp8 PE=2 SV=2
8	P45452	1.24e-58	195	471	0.398	0.221	MMP13_HUMAN Collagenase 3 OS=Homo sapiens OX=9606 GN=MMP13 PE=1 SV=1
9	P28862	7.32e-58	193	477	0.406	0.222	MMP3_MOUSE Stromelysin-1 OS=Mus musculus OX=10090 GN=Mmp3 PE=2 SV=2
10	P03957	3.10e-57	191	475	0.387	0.213	MMP3_RAT Stromelysin-1 OS=Rattus norvegicus OX=10116 GN=Mmp3 PE=1 SV=1
11	P39900	1.44e-56	189	470	0.414	0.230	MMP12_HUMAN Macrophage metalloelastase OS=Homo sapiens OX=9606 GN=MMP12 PE=1 SV=1
12	P08254	2.25e-56	189	477	0.410	0.224	MMP3_HUMAN Stromelysin-1 OS=Homo sapiens OX=9606 GN=MMP3 PE=1 SV=2
13	P57748	2.47e-56	189	482	0.349	0.189	MMP20_MOUSE Matrix metalloproteinase-20 OS=Mus musculus OX=10090 GN=Mmp20 PE=2 SV=1
14	P33435	3.00e-56	189	472	0.395	0.218	MMP13_MOUSE Collagenase 3 OS=Mus musculus OX=10090 GN=Mmp13 PE=1 SV=1
15	O88766	7.01e-56	187	466	0.379	0.212	MMP8_RAT Neutrophil collagenase OS=Rattus norvegicus OX=10116 GN=Mmp8 PE=2 SV=1
16	P22894	1.69e-55	186	467	0.349	0.195	MMP8_HUMAN Neutrophil collagenase OS=Homo sapiens OX=9606 GN=MMP8 PE=1 SV=1
17	P09238	4.02e-55	186	476	0.414	0.227	MMP10_HUMAN Stromelysin-2 OS=Homo sapiens OX=9606 GN=MMP10 PE=1 SV=1
18	O60882	2.47e-54	184	483	0.333	0.180	MMP20_HUMAN Matrix metalloproteinase-20 OS=Homo sapiens OX=9606 GN=MMP20 PE=1 SV=3
19	Q10738	3.52e-54	177	264	0.383	0.379	MMP7_MOUSE Matrilysin OS=Mus musculus OX=10090 GN=Mmp7 PE=1 SV=1
20	P23097	6.08e-54	182	466	0.360	0.202	MMP13_RAT Collagenase 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Mmp13 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01400 Astacin	82	14.3	Astacin (Peptidase family M12A)
2	PF16313 DUF4953	4.1	18.1	Met-zincin
3	PF12044 Metallopep	81	13.2	Putative peptidase family
4	PF00413 Peptidase_M10	4.3e-52	187.6	Matrixin
5	PF05572 Peptidase_M43	86	14.5	Pregnancy-associated plasma protein-A
6	PF07998 Peptidase_M54	2.5e+02	13.1	Peptidase family M54
7	PF12388 Peptidase_M57	6.7	17.8	Dual-action HEIGH metallo-peptidase
8	PF10462 Peptidase_M66	1.4e+02	12.9	Peptidase M66
9	PF13582 Reprolysin_3	0.12	24.2	Metallo-peptidase family M12B Reprolysin-like
10	PF13583 Reprolysin_4	7	17.8	Metallo-peptidase family M12B Reprolysin-like
11	PF13688 Reprolysin_5	4.8	18.8	Metallo-peptidase family M12

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369753

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287814	0.780	Metalloproteinase inhibitor 4
2	9606.ENSP00000265983	0.645	Hemopexin
3	9606.ENSP00000368304	0.602	Melanoma-associated antigen B10
4	9606.ENSP00000388895	0.569	Spermatogenesis-associated protein 3
5	9606.ENSP00000218388	0.510	Metalloproteinase inhibitor 1
6	9606.ENSP00000266085	0.503	Metalloproteinase inhibitor 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004222	0.999	metalloendopeptidase activity
GO:0005488	0.988	binding
GO:0005515	0.837	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048519	0.956	negative regulation of biological process
GO:0048583	0.853	regulation of response to stimulus
GO:0048585	0.802	negative regulation of response to stimulus
GO:0050794	0.715	regulation of cellular process
GO:0080134	0.711	regulation of response to stress
GO:0031347	0.595	regulation of defense response
GO:0050727	0.590	regulation of inflammatory response
GO:0031348	0.526	negative regulation of defense response
GO:0048523	0.464	negative regulation of cellular process
GO:0050896	0.459	response to stimulus
GO:0048518	0.438	positive regulation of biological process
GO:0032102	0.434	negative regulation of response to external stimulus
GO:0050728	0.401	negative regulation of inflammatory response
GO:0019222	0.392	regulation of metabolic process
GO:0009987	0.348	cellular process
GO:0010605	0.313	negative regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0031982	0.882	vesicle
GO:0005615	0.878	extracellular space
GO:0005737	0.846	cytoplasm
GO:0043229	0.652	intracellular organelle
GO:0043231	0.526	intracellular membrane-bounded organelle
GO:0070013	0.308	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.24.-	0.999	Metalloendopeptidases.

[back to server]